KEGG   Desulfurococcus mucosus: Desmu_1055Help
Entry
Desmu_1055        CDS       T01406                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dmu  Desulfurococcus mucosus
Pathway
dmu00020  Citrate cycle (TCA cycle)
dmu00640  Propanoate metabolism
dmu00720  Carbon fixation pathways in prokaryotes
dmu01100  Metabolic pathways
dmu01110  Biosynthesis of secondary metabolites
dmu01120  Microbial metabolism in diverse environments
dmu01130  Biosynthesis of antibiotics
dmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desmu_1055
   00640 Propanoate metabolism
    Desmu_1055
   00660 C5-Branched dibasic acid metabolism
    Desmu_1055
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desmu_1055
Enzymes [BR:dmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desmu_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig NAD_binding_10 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADV65357
UniProt: E8RA31
Position
complement(1036869..1038008)
Genome map
AA seq 379 aa AA seqDB search
MKLYEYEGKEIARRYGVDVPRGLLASSVEEVAEAYRRLGSQVVVLKAQVLVGGRGLAGGV
KKAGSLEEAVAKAGELFSTSIRGERVGKLLVEEAVCISRELYVSLTVDRASRRLVYLVSG
MGGVEIEELARRHPDKVLRIPVDPFNGFSSYMARQALGFLGLPWDKLGVLENVMRAMYRI
MVDYDAELVEFNPLAYTCSGGLTALDAKVIVDDNSLYRHPDLQPLYGRDASSYERLAKQL
EFNYVELDGDIGVISNGAGLTMATMDAILHYGGRPANFLDIGGGATRERVREAAKIVLTH
PRVKAVLVNIFGGITRCDEVAAGVVEALKEAGVAKPVVVRMLGTNEEEGRRILREHGINA
YTEMDEAVLKVVQLAREVG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctacgagtatgagggtaaggagatagctaggaggtatggtgtcgacgtcccc
agggggctccttgcctcgagtgttgaggaggttgcggaggcgtataggaggcttggctcc
caagtggtggttttaaaggcgcaggtgcttgtaggcggtaggggtttagccggcggcgtg
aagaaggctgggagccttgaggaagcggtggctaaggccggcgagctgttctccacgagt
ataaggggtgagagggttgggaaactccttgtcgaggaggctgtctgcatctcccgcgag
ctctacgtctccctcaccgttgacagggcgtcgaggaggctggtctaccttgtctcaggg
atgggcggggtggagatagaggagcttgcgaggaggcacccggataaggtacttaggatc
cctgtagaccccttcaacgggttcagcagctacatggctaggcaggcgctgggcttcctc
gggcttccatgggataaactaggggttctcgagaacgttatgagagccatgtacaggatt
atggttgactacgatgccgagctcgttgagttcaacccgcttgcatacacgtgtagcggg
gggcttacagccctggatgccaaggtgatcgtggacgataacagcttgtacaggcacccg
gatctacagcccctctacgggagggatgcatccagctatgagcggcttgccaagcagttg
gagttcaactacgtggagctggacggcgatataggggtgataagtaatggagccgggttg
accatggccacgatggacgccatcctccactacggtgggaggccggctaacttcctggat
atagggggtggggcaacccgtgaaagggttagggaggctgctaaaatagtgctcactcat
ccaagggttaaagcagtcctcgtcaacatatttggaggtataacgagatgcgatgaggtt
gcagcaggagtcgttgaagccttgaaggaggccggggtggctaagccagtcgtggtcagg
atgcttggcaccaatgaggaggaggggaggaggatactcagggagcacgggataaacgct
tacacggagatggatgaagcggttttaaaagtggttcaactagcgagggaggtgggttag

DBGET integrated database retrieval system