KEGG   Desulfurococcus mucosus: Desmu_1262Help
Entry
Desmu_1262        CDS       T01406                                 

Definition
(GenBank) protein of unknown function DUF127
  KO
K07254  tRNA (cytidine56-2'-O)-methyltransferase [EC:2.1.1.206]
Organism
dmu  Desulfurococcus mucosus
Brite
KEGG Orthology (KO) [BR:dmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dmu03016]
    Desmu_1262
Enzymes [BR:dmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.206  tRNA (cytidine56-2'-O)-methyltransferase
     Desmu_1262
Transfer RNA biogenesis [BR:dmu03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    Desmu_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trm56
Motif
Other DBs
NCBI-ProteinID: ADV65558
UniProt: E8R793
Position
1208959..1209501
Genome map
AA seq 180 aa AA seqDB search
MKIYVLRYGHRPGRDKRVTTHVALVARAFGADGFILGDVADESVKESIEKVSEIWGGRIH
FEMGVDSQKYCREWKRNGGLVVHLTMYGLHVDSVIDEVRRLGRDILVVVGSRKVPGFFYE
VADYNVAIGHQPHSEVAALAVFLDRLFTGRELYLRFPDAKVEIVPSPRGKKVRRLGAGVE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatatatgtgttgagatacgggcataggcctggcagggataaaagggttacaacc
catgttgcactcgtggcacgtgccttcggggcagacgggttcatccttggcgatgttgcc
gatgaatcagtgaaggagtcgattgagaaggtatcggagatatggggtggcaggatccac
tttgagatgggggttgactcgcagaagtactgtagggagtggaagaggaacggcggctta
gtggttcatttaacaatgtacggcctccacgttgacagcgtgatcgacgaggtgaggagg
ctgggtagggatatactggtggttgtgggatccaggaaggtgccggggttcttctacgag
gtggcagactataatgtagcaataggtcatcaaccccactcagaggtagccgccttagcg
gtcttcctcgacagactgttcactgggagagaactctacctgaggttccctgatgcaaag
gttgaaatagtgccgtctccccgtggcaagaaggttaggaggcttggagccggcgtggag
tga

DBGET integrated database retrieval system