KEGG   Dehalococcoides mccartyi CG1: X792_03225Help
Entry
X792_03225        CDS       T03647                                 

Definition
(GenBank) acetyl-CoA synthase subunit gamma
  KO
K00197  acetyl-CoA decarbonylase/synthase, CODH/ACS complex subunit gamma [EC:2.1.1.245]
Organism
dmx  Dehalococcoides mccartyi CG1
Pathway
dmx00680  Methane metabolism
dmx01100  Metabolic pathways
dmx01120  Microbial metabolism in diverse environments
dmx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmx00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    X792_03225
Enzymes [BR:dmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.245  5-methyltetrahydrosarcinapterin:corrinoid/iron-sulfur protein Co-methyltransferase
     X792_03225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CdhD FeS
Motif
Other DBs
NCBI-ProteinID: AII57798
UniProt: A0A076I9P2
Position
complement(594136..595482)
Genome map
AA seq 448 aa AA seqDB search
MSPTGIEIYKFLPRTNCGECGVPTCLAFAMSLAGGRAELSACPYVSEEAKQKLEEASAPP
VRTVSIGTGDYSFKTGGETVMHRHEKRFEHQPGIALLISDSLSETEQDAKLAAFNRFQYK
RVGAILKPDMLALRADSGSGEKYLKLVKLAAEKCPASLMLMCADTAVLDESLKICAERKP
LLYAATAENSSEMAELAKKYNCPLVAKAANLADLADLSVKLQSLGIKDIVLDSSAENLKQ
ALSDNVAIRRSAISKKFRPMGFSVINFPCQMTQDPMKESLFAGILTAKYAGILVLSDFSG
ETLFPLLVTRMNLYTDPQRPLATTEGIYEINTPDANSPVMLTCNFSLTYFIVSGEMENSR
VPCYLMIKDTEGLSVMTAWAAGKFGADTIGKFVKNSGIAAKINHRKLIIPGYASMESGGL
EEELSGWEIMVGPREAAHIPAYLKQFKP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcacctaccggtatagaaatttataaatttttaccccgaaccaattgcggcgaatgc
ggcgtacccacttgtctggcattcgccatgagtctggcaggaggccgggctgaactttct
gcctgcccttacgtttcggaagaagccaaacaaaagctggaggaagcttccgcccccccg
gtcaggacagtgagcataggtacaggtgattactcttttaaaaccggcggcgaaactgtc
atgcaccgccatgaaaaacgctttgagcaccagccgggtattgccctgctcatctcagac
agcctgagcgagacggaacaggatgccaaactggccgctttcaaccgttttcagtacaaa
cgggtgggtgctattctgaagccggatatgctggcactcagggcagacagcggctcaggt
gaaaaatacctgaagctggtcaaactggccgccgaaaaatgcccggccagcctcatgctg
atgtgtgctgataccgccgtacttgatgaatctttgaagatttgcgctgaacgcaaaccg
cttctttacgccgccacagccgaaaacagcagcgaaatggcagagctggctaaaaaatac
aactgtccgctggtagccaaagcggctaacctggcagatttggctgaccttagcgttaaa
cttcaatcactgggaataaaagatattgtgctggacagctctgccgaaaatttaaaacag
gccttatctgacaacgttgccataagacgctcagccatttcgaaaaaattccggcccatg
ggtttttcggtcatcaatttcccctgccagatgacccaagaccccatgaaagaatcactt
tttgccggcatactgactgccaaatatgcaggtatactggtgctgtctgactttagcggt
gaaaccctgttccctttgctggtaacacgtatgaacctttacaccgacccccagcggcct
ttggctactaccgagggtatttatgaaataaacaccccggatgccaattcacctgtcatg
cttacctgcaatttctcgctgacatattttattgtctccggtgagatggaaaacagccgt
gtaccctgttacctgatgataaaagacaccgaagggctttcggtcatgaccgcctgggca
gcaggcaaattcggggctgataccattggtaaatttgtaaaaaacagcggcattgccgct
aaaatcaaccaccgcaagctgattataccgggctacgcttcaatggaaagcggaggtctg
gaagaagaattatccggttgggagataatggtcggtccgcgtgaagccgctcatataccg
gcctatttaaagcagtttaaaccctaa

DBGET integrated database retrieval system