KEGG   Dehalococcoides mccartyi CG4: X793_00655Help
Entry
X793_00655        CDS       T03648                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
dmy  Dehalococcoides mccartyi CG4
Pathway
dmy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dmy01100  Metabolic pathways
dmy01110  Biosynthesis of secondary metabolites
dmy01130  Biosynthesis of antibiotics
dmy01230  Biosynthesis of amino acids
Module
dmy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dmy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    X793_00655
Enzymes [BR:dmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     X793_00655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N FMN_dh
Motif
Other DBs
NCBI-ProteinID: AII58899
Position
131673..132797
Genome map
AA seq 374 aa AA seqDB search
MDENRVKNFGAVISRLISKENLNREEVKDCFCQIMRNEQPDLQQGAFMAALTAKGETAPE
IAGVWEAIYEQDTVRVKPLVNKPLVDNCGTGMDSLKTFNISTAASIVAAAGGVVLAKHGA
RALSGSLGTIDMLESLGVDVETDVETVRLSIETAGIGIFNGMSAQVHPQALFRILSQIRF
GTTLNIAGSLANPALPRYAVRGVYSAELLQPVAEVMREIGYKKALVIYGSAPGGRGMDEL
SVLGESRIAELGEDGQIIKYSLSPADFGLKPGRTEDILTSGDKQRETLRLLRILSGGENG
AAFDAVCLNAAPVFYIAGEADSLQQGYAKAAEIIRSGAAIAKLRQWVQTQNSNPQAGLAR
LDSLLAELDGTKVS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtggacgaaaacagggtaaaaaatttcggggctgtcataagccgccttatttcaaaggaa
aatcttaaccgtgaagaagtaaaagactgtttctgccagataatgcggaatgaacagcct
gacctccagcagggtgcctttatggccgccctaaccgccaagggtgaaacagcaccggag
atagccggtgtctgggaagctatatatgagcaggatacggtaagggttaagcctttggta
aataaacctttggtggataactgcggtacgggcatggacagcctgaagacctttaacatc
agcacggctgcttccattgtggcggcggcgggcggggtggtgctggcaaaacacggtgcc
agagccctttccgggagcttagggactattgatatgctggaatcactgggtgttgacgtg
gaaacagacgtggagaccgtcaggctgagtattgaaacggcgggtataggcatttttaac
ggcatgagcgcccaggttcacccccaggctcttttccgtatcctttcccagatacgtttc
gggactacccttaatattgccggttcgctggcaaacccggctttgccccgttatgcggtc
aggggggtatattcggccgaactattgcagccggtggctgaggtgatgcgtgagataggt
tataaaaaagccctggttatctacggctctgcccccggcggccggggaatggatgaactt
tccgttttgggcgaaagccgcattgccgagcttggcgaagacgggcagattattaagtac
agcttgtccccggcagattttggtttaaaacccggccggacggaggatatacttacttca
ggtgataaacaacgcgaaaccctgcggcttctccgtattctttctggcggtgaaaacggg
gctgcctttgacgcggtttgtctgaatgctgctcctgttttttatatagccggtgaggct
gacagtcttcagcagggttatgccaaagcggcggagataatccgttccggtgcggctatt
gccaagcttcggcagtgggtgcagacccagaattccaacccccaagccggtcttgcccgg
ctggacagcctgttggctgaactggacggaacaaaggtcagctaa

DBGET integrated database retrieval system