KEGG   Dichelobacter nodosus: DNO_1334
Entry
DNO_1334          CDS       T00517                                 

Symbol
pflB
Name
(GenBank) pyruvate-formate lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
dno  Dichelobacter nodosus
Pathway
dno00620  Pyruvate metabolism
dno00640  Propanoate metabolism
dno00650  Butanoate metabolism
dno01100  Metabolic pathways
dno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DNO_1334 (pflB)
   00640 Propanoate metabolism
    DNO_1334 (pflB)
   00650 Butanoate metabolism
    DNO_1334 (pflB)
Enzymes [BR:dno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     DNO_1334 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF5713
Other DBs
NCBI-ProteinID: ABQ13370
UniProt: A5EX31
Position
complement(1360990..1363287)
AA seq 765 aa
MKDVHENSVAWKGFTAGNWQENVDVRDFIQKNYTPYEGDGSFLQGPTEATTRLWNTVAEM
IKVENRTHAPYDVDTDTISTITSHEAGYIDKSLETIVGLQTDAPLKRAIMPFGGLRMVEG
SCKVYNKTLNPLVSEIFTKYRKSHNQGVFDVYTPDILRCRKAGILTGLPDAYGRGRIIGD
YRRVALYGIDRLMEDKTNQFNSLQPELESGENIEEVIRRREEIKEQFLALGQMKEMAAKY
GFDISQPAKNAKEAIQWTYFGYLAAIKSQNGAAMSFGRVSSFLDIYIERDLKAGLITESQ
AQEMVDHLVMKLRMVRFLRTPEYDELFSGDPMWATESIGGMGLDGRTLVTKNSFRFLQTL
YNMGTSPEPNMTILWSEKLPQNWKEFCAKVSIDTSSVQYENDDLMRPDFQYDDYAIACCV
SPMRVGKQMQFFGARANLAKTLLYTINGGMDEKLKIQVGPKMEPILDEVLDYDVVMEKMD
HFMDWLAKQYMTALNIIHYMHDKYSYEAALMALHDRDIIRTMACGIAGLSVAADSLSAIK
YAKVTPIRDENNIAVDFKIEGEYPQFGNNDDRVDSIACYLVERFMSKLSKLKTYRNATPT
QSVLTITSNVVYGKKTGTTPDGRKAGLPFGPGANPMHGRDVKGAVASLTSVAKLPFAFAK
DGISYTFSIIPNALGKDSETRSRNLAGLMDGYFHHEAANDGSIIVEGGQHLNVNVLNREM
LLEAMEDPEKYPQLTIRVSGYAVRFNSLTREQQQDVITRTFTQTM
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgaaagacgttcatgaaaattcggtggcttggaaaggattcaccgcaggcaattggcaa
gaaaatgttgatgttcgtgacttcatccaaaagaattatactccttatgaaggagatggc
tctttcttacaaggtcctacagaagcaactactcgtttgtggaataccgttgctgaaatg
atcaaggttgaaaaccgtacgcacgctccttacgatgttgataccgataccatttcaact
atcacttctcacgaagctggctatattgacaaatcattggaaactattgttggtttacaa
actgatgctcctttaaaacgcgcgatcatgccatttggcggtttgcgcatggttgaaggc
agctgcaaagtttataacaaaacccttaaccctttagtttctgaaatctttactaaatac
cgcaaatcacacaaccaaggcgtatttgatgtttatacaccggatattttgcgttgccgt
aaagcgggtattttaacaggattgcctgatgcttacggtcgtggtcggattattggtgac
tatcgccgcgttgcgctttatggtatcgaccgtttaatggaagataaaaccaaccaattc
aactcattacaacctgaattagaatctggcgaaaacattgaagaagtcattcgccgtcgc
gaagaaatcaaagaacaattcctcgctttaggtcaaatgaaagaaatggcagcaaaatac
ggctttgacatttctcaaccagcaaaaaatgcaaaagaagcgattcaatggacttatttt
ggttacttagcagccattaaatctcaaaacggtgcggcaatgtcatttggtcgcgtttca
agtttcttagatatttatatcgaacgtgacttaaaagccggcttaattaccgaatctcaa
gctcaagaaatggttgaccatttagtgatgaaattacgtatggttcgtttcttgcgtact
ccagaatacgatgaattattctctggcgacccaatgtgggcaaccgaatctatcggcggt
atgggcttagatggtcgtactttggttaccaaaaacagcttccgatttttgcaaaccttg
tacaacatgggaacttctccagaaccaaacatgactatcttgtggtcagaaaaactgccg
caaaactggaaagaattctgtgctaaagtttctatcgatacttcttcagtgcaatatgaa
aacgacgatttaatgcgtcctgatttccaatatgatgactacgctattgcttgctgcgtc
agcccaatgcgtgttggtaaacaaatgcaattcttcggtgcgcgtgcaaacttagcaaaa
actttgttatacaccattaacggcggtatggacgaaaaattgaaaatccaagtcggcccg
aaaatggaaccaattttagatgaagttttagattacgacgtcgtcatggaaaaaatggat
cacttcatggattggttagcaaaacaatacatgaccgctttaaatatcattcattacatg
cacgataaatacagctatgaagcagcgttgatggcattgcatgatcgcgacatcattcgc
accatggcttgcggtatcgcagggttatctgttgcagcggattcattgtctgctattaaa
tacgcaaaagttaccccgattcgtgacgaaaacaatatcgcggttgacttcaaaattgaa
ggcgaatatccgcaatttggtaacaacgatgaccgcgttgacagcattgcttgctactta
gtagaacgcttcatgtcaaaattgagcaagttaaaaacttaccgcaatgcaacaccaact
caatccgttttaaccattacttctaacgttgtttatggtaagaaaacaggtactactcct
gacggacgtaaagctggtttaccgtttggaccgggtgcaaacccaatgcatggtcgcgat
gtaaaaggcgccgttgcttctttaacttcagttgcaaaattgccgtttgcctttgcgaaa
gatggtatttcttatactttctcaattattccaaatgcattaggtaaagacagcgaaaca
cgcagccgtaacttagctggtttgatggatggatatttccaccacgaagccgcaaacgat
ggcagcatcattgttgaaggcggacaacatttgaacgttaacgtcttgaatcgtgaaatg
ttattagaagctatggaagatccagaaaaatatccacaattaaccattcgtgtttctggc
tatgccgtacgctttaactcattaacacgtgaacaacaacaagatgttattacacgtacc
tttactcaaaccatgtaa

DBGET integrated database retrieval system