KEGG   Dichelobacter nodosus: DNO_0408Help
Entry
DNO_0408          CDS       T00517                                 

Gene name
recD
Definition
(GenBank) exonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dno  Dichelobacter nodosus
Pathway
dno03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dno00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DNO_0408 (recD)
Enzymes [BR:dno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DNO_0408 (recD)
DNA repair and recombination proteins [BR:dno03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DNO_0408 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD DUF2075 UvrD-helicase PhoH UvrD_C AAA_22 Herpes_Helicase PIF1 AAA_5 NACHT ResIII Terminase_6 AAA
Motif
Other DBs
NCBI-ProteinID: ABQ13585
UniProt: A5EVY1
Position
450954..452528
Genome map
AA seq 524 aa AA seqDB search
MPINDTDKNHFIGAFLAQRAGGCSENFVPHFERVMTAIAAGNTVVAAENAIADGALIVTA
DAAKKGAVAPLVSDGTFLWLYRLWFQEWRLASCIQKKLNAADDSILEHNSFDDGLNAEQK
QALKMGLTRQLSIINGGPGTGKTFTVARIVAALLARDPDLTIALAAPTGKAAQRLEIALH
QAFITAQLTRPTQLTTAQTVHRLLGVDNTGTARYHEHYFLPYDVVIIDEASMLSLELAAQ
LFQALAPHTRIILLGDAQQLAAVEAGAVLHDLAQQSALNHHVVTLQESRRFHQTSGIGIL
ARCTQNASQTALTAALEHEDIALSPLARRPNYDRLYEPYRDYVAKVAAGAAVDVLLQQFD
NYRILTKTRYGAYGTAAVNEQMKKRHLAQMGVNGKRAFYQGAPVMVTRNNYAHGVFNGDI
GICLADERGQMLVYFREDFAVPLLFLKSDDLDFAYALTIHKAQGSEFEQVALLLDKQEEG
LTRELVYTGITRAKKQLLLETTPAILLKAMQTPTQRLTGLSTFF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaatgatacggacaaaaatcattttatcggcgcgtttttagcacaaagggcg
ggcggttgttcggaaaattttgtgcctcattttgaacgcgtgatgacggcaatcgctgcc
ggaaatacggtagttgccgcagaaaatgcgattgccgacggcgcgttaattgtaacggca
gatgcggcaaaaaagggcgcggtggcgccgttggttagtgatggtacttttttatggctt
tatcggctgtggtttcaggagtggcgtttggcgagttgcattcaaaaaaaattaaatgcc
gccgacgattctattttggaacataattcatttgatgacggtttaaatgccgaacaaaag
caagcgcttaaaatgggattgacgcggcaattaagcattattaatggcgggccgggtacg
ggaaaaacgtttaccgtggcgagaatcgttgccgctttattggcacgagatcccgattta
acaattgcattagccgcgccaacgggaaaagcggctcaacgtttggaaatcgcgttgcat
caggcttttataacggcgcaattaacgcgtccgacgcaacttaccaccgcgcagacggtg
catcgtttattgggcgtggataacacgggaacggcgcgttatcacgaacattatttttta
ccgtatgacgtggtgattatcgatgaagcttcgatgctgtcgctagaattagccgcgcaa
ttgtttcaagcgctggcgccgcatacccgcatcattttattaggcgatgcgcagcaatta
gccgcggtggaggcgggcgcggtgttgcatgatttggcgcaacaatcagcgttaaatcat
catgtggtgacgttacaagaatcacggcgttttcatcaaacatcgggcattgggattttg
gcgcggtgcacacaaaatgcatcgcaaacggcgttaaccgcggcgttagagcacgaagat
attgctttatcaccgttggcgcggcgcccgaattatgatcgtttatatgaaccatatcgc
gattatgtggcaaaggtggcggcgggcgcggcggttgatgttttattacaacagtttgat
aattatcgtattttaacgaaaacacgttatggtgcgtacggaacggcggcggtgaatgag
cagatgaaaaagcggcatttagcgcagatgggcgttaacggaaaacgcgctttttatcag
ggcgctccggtgatggtgacgcgcaataattatgcgcacggcgtttttaatggcgatatt
ggcatttgtcttgccgatgagcggggacagatgttggtttattttcgtgaagatttcgct
gtgccgttattgtttttaaaatcggatgatttggattttgcttatgcgttaacgattcat
aaagcacaggggtcggaatttgagcaggtagcgttattgttggataaacaggaagaaggt
ttgacgcgggaattagtttatacgggcattacgcgggcaaaaaaacaattattgcttgag
acgacgccggcaattttattaaaagccatgcaaacacccacgcaacgtttaacaggttta
tccacttttttttaa

DBGET integrated database retrieval system