KEGG   Dichelobacter nodosus: DNO_0585Help
Entry
DNO_0585          CDS       T00517                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dno  Dichelobacter nodosus
Pathway
dno00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dno01100  Metabolic pathways
dno01110  Biosynthesis of secondary metabolites
dno01130  Biosynthesis of antibiotics
dno01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dno00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DNO_0585 (trpC)
Enzymes [BR:dno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DNO_0585 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C Cellulase
Motif
Other DBs
NCBI-ProteinID: ABQ13361
UniProt: A5EVG3
Position
622906..623709
Genome map
AA seq 267 aa AA seqDB search
MTKILDDIVAYKQQEIAALKQQKTEASLIAELETLTDAPRGFMRALRDCRDRGGVAVVAE
IKRASPNQGLLREQFMPELLAQECVQYGASCLSVFTDTHFFYGDVAYLSAVKKAVPVPVL
RKDFIISRYQILESRLLGVDCILLIVAILTDEQLQEFVVLAHDLGMDVLIEIHDENDLKR
ALNVPVRTLAINNRNPEDFNASLEKSAQLRQQLPKDYFVISESGINTHADVVYLLNCGLD
AVLIGGALMSAEFAGEALHHLIYGKED
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagattcttgatgatattgttgcttataaacaacaagaaattgccgctttaaaa
cagcaaaaaacagaagcctctttgattgcagaattggaaacgttaaccgatgcgccgcgt
ggttttatgcgtgcattgcgtgattgtcgagatcgcggcggcgttgccgttgttgccgaa
attaaacgcgcgtcaccgaaccaaggtttattgcgggaacagtttatgccggaactttta
gctcaagaatgcgtgcaatacggcgccagttgtctttccgtatttacggatacgcatttt
ttctacggcgatgtggcttatttaagcgcggtaaaaaaggcggtgccggtgcccgttttg
cgcaaggattttattattagccgttatcaaattttggaatcacgacttttaggcgtcgat
tgtattttattgattgtggcaattttaacggacgaacaattacaggaattcgttgtttta
gcgcatgatttgggtatggacgtgttaattgaaatccacgatgaaaacgatttgaaacgg
gcgcttaatgtgccggtgcggacgttggcaattaacaatcgtaatcccgaagattttaat
gcttcattggaaaaatcggcgcaattgcggcaacaattgccgaaagattattttgttatc
agcgaaagcggtattaatacgcatgctgatgtggtgtatttgctcaattgcgggcttgat
gccgttttaattggcggcgcgttgatgagtgctgaatttgctggagaggcgttacatcat
ttaatttatggaaaagaggattga

DBGET integrated database retrieval system