KEGG   Drosophila navojoa: 108649339Help
Entry
108649339         CDS       T05898                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dnv  Drosophila navojoa
Pathway
dnv00350  Tyrosine metabolism
dnv00360  Phenylalanine metabolism
dnv00380  Tryptophan metabolism
dnv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108649339
   00360 Phenylalanine metabolism
    108649339
   00380 Tryptophan metabolism
    108649339
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnv04147]
    108649339
Enzymes [BR:dnv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     108649339
    4.1.1.105  L-tryptophan decarboxylase
     108649339
Exosome [BR:dnv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108649339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 108649339
NCBI-ProteinID: XP_017953798
Position
3
AA seq 466 aa AA seqDB search
NKTNAIVVPLCRRVLPEVKPGYLQPLIPDAAPEKPEDWQDVMKDIERVIMPGVTHWHSPK
FHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMLDWLGKMLDLPAEFLAC
SGGKGGGVIQGTASESTLVALLGAKAKKIQQVKKEHPEWDEHTIIGKLVGYSSAQAHSSV
ERAGLLGGVKLRSVPADEHNRLRGDALEQAIKEDLAAGLIPFYAVVTLGTTNSCAFDRLD
ECGAVANKYNVWVHVDAAYAGSAFICPEYRHHMKGIETADSFNFNPHKWMLVNFDCSAMW
LKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAH
IRRHCGFAKQFGDLCQQDKRFELAAEVSMGLVCFRLKGSNERNEALLKRINGRGNIHMVP
AKIRDVYFLRMAVCSRFTRSEDMEYSWKEVSAAADELEKSEAAEKQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
aataagactaatgcaattgttgttcctctttgcaggcgggtactgcccgaggtgaagcct
ggctatttgcagccattgataccagatgctgcaccagagaagccggaggattggcaggat
gtgatgaaggacattgagagagtcatcatgccgggtgtgacccactggcacagycccaag
ttccatgcctatttcccgacagccaactcgtatccagccatcgtagcggacatgctgagt
ggagcgattgcttgcatcggattcacttggatagcgagtccggcctgcacggagctggag
gtggttatgctcgattggctgggcaagatgctggatctgccagcggaatttttggcctgc
tctggaggaaaaggtggcggtgtcattcagggaacagccagcgagtcgactctggtggct
ctgctgggcgccaaggccaagaagatacagcaggtaaagaaggagcatccggagtgggat
gagcacacaatcattggcaagctggtgggctattcctcggcccaggcccattcctctgtg
gagcgagctggtctcttgggcggcgtcaagttgcgttcagttccggctgatgagcacaat
cgtctgcgtggcgatgccttggagcaggcaattaaagaggatttggctgctggcctaata
cccttttacgctgttgtcaccttgggcacgactaactcgtgcgccttcgatcgactggat
gagtgcggtgctgtggccaacaagtacaacgtgtgggttcatgtggatgcggcctatgca
ggctcagctttcatctgccccgagtaccgtcaccacatgaagggcatcgagactgccgat
tccttcaacttcaatccacacaaatggatgctggtcaactttgactgctcggccatgtgg
ctgaaggaccccagttgggtggtaaacgctttcaatgttgatcccctgtacctaaagcac
gacatgcagggctccgcgcctgactatcgccactggcaaatcccattgggtcgccgtttc
cgcgccctcaagctctggttcgtgctgcgtctgtacggtgttgagaatctgcaggcacat
atcagacgccactgcggctttgccaagcagttcggtgatctctgccagcaggacaagcgc
tttgagctggctgcagaagtgagcatgggcctggtttgcttccggctaaagggcagcaac
gagcgcaacgaagcgctgctgaagcggatcaatggacgtggcaacattcacatggtgccc
gctaaaatacgcgacgtttacttcttacgcatggccgtctgctcgcgtttcacacgatcc
gaggacatggagtactcctggaaggaagtcagcgctgcagccgatgaactggaaaagtct
gaggcagctgaaaagcagtaa

DBGET integrated database retrieval system