KEGG   Drosophila navojoa: 108650614Help
Entry
108650614         CDS       T05898                                 

Definition
(RefSeq) palmitoyltransferase ZDHHC6
  KO
K20031  palmitoyltransferase ZDHHC6 [EC:2.3.1.225]
Organism
dnv  Drosophila navojoa
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dnv04131]
    108650614
Enzymes [BR:dnv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     108650614
Membrane trafficking [BR:dnv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    108650614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC SH3_2 TMEM213
Motif
Other DBs
NCBI-GeneID: 108650614
NCBI-ProteinID: XP_017955289
UniProt: A0A484BH91
Position
4
AA seq 413 aa AA seqDB search
MTYHDDPNELGLFWHWGPIVTLIVSATVTLTTWKWWPPEESLFWSAHFALYMLLNVLSLY
NFVNAVLVGPGLLPRGWHPANPKEAKYMQYCKKCEGYKAPRVHHCRRCDRCVMKMDHHCP
WINRCVGWSNQMYFVSFLFFYLMSNLHAFCVITISGYQFFMDSTEIARRHYNGHLERYLR
QHFFGLFMAITSFGLTIGIVLCMLKLLIIQIGAILKNVTDVEQWIVEKARARRYKKNMKP
FVFPYNLGWKLNLAEVFNIEQQHRGHGIEFPVVKGCNQYTLTLEQLAQKAEKRNRTRTYK
CILPATGSWLPIWSQGLRVTFDSPLTDDPRIKLEPNDLIRVTRKRKHWLFGERVVGDDRR
TGAIRGWFPRRCAIEVNDNGDSFAHAAANPEAAHESRRKVGKPKKSDKTNKDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacataccatgatgatccgaatgagctgggtctcttttggcactggggacccatagta
acgctgattgttagcgccaccgttaccttgaccacctggaagtggtggccgccggaggag
tccttattctggagcgcccatttcgcactctatatgctactcaatgtgctgtcgctgtac
aactttgtgaacgccgtgttggtggggccgggcctcttgccgcgcggctggcaccctgcg
aaccccaaggaggcgaaatatatgcagtactgcaagaagtgtgagggctacaaggcgccg
cgggtgcatcactgtcgtcgctgcgatcgttgtgtgatgaaaatggatcatcattgtccg
tggatcaatcgctgtgtgggctggtcgaatcaaatgtatttcgtatcatttctgttcttc
tatttgatgagcaacttgcatgccttctgtgtgattaccatttccggctatcagttcttc
atggacagcaccgaaatagctcgtcgccactataacggccatttggaacggtatcttcgt
cagcatttctttggcttattcatggcaatcacgagctttgggctcaccatcggcatagtg
ctgtgcatgctgaagctgctgatcatccagatcggtgccatactcaagaatgttacggac
gtggagcaatggattgtggagaaggcacgcgcacgccgctataagaagaatatgaaacca
ttcgtgtttccctacaatcttggctggaaattaaacctagctgaggtgtttaacattgag
caacagcatcgcggccatggcatcgagtttcccgttgtgaagggctgtaatcaatacacg
ctcacattggagcagctcgcacagaaggccgagaaacgcaatcgcacgcgcacctacaag
tgcatattgcccgcaactggcagctggctgcccatctggtcgcagggcttgcgggtgacg
ttcgactctcccctcacggacgatccgcgcatcaagctggagccaaacgatctcatacgg
gtcacacgcaagcgcaagcattggctcttcggagagcgagttgtgggcgacgataggcgc
acgggcgcgattcgtggctggttccccagacgctgtgctatcgaggtgaatgataacggc
gactcgttcgctcatgctgccgccaatccagaggcggcccatgagagccgacgtaaagtt
ggcaagccaaagaagtcagacaagaccaataaggatctgtag

DBGET integrated database retrieval system