KEGG   Drosophila navojoa: 108650745Help
Entry
108650745         CDS       T05898                                 

Definition
(RefSeq) muscle M-line assembly protein unc-89
  KO
K12567  titin [EC:2.7.11.1]
Organism
dnv  Drosophila navojoa
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dnv01001]
    108650745
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dnv04131]
    108650745
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dnv04812]
    108650745
   04147 Exosome [BR:dnv04147]
    108650745
Enzymes [BR:dnv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108650745
Protein kinases [BR:dnv01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108650745
Membrane trafficking [BR:dnv04131]
 Others
  Actin-binding proteins
   Others
    108650745
Cytoskeleton proteins [BR:dnv04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108650745
Exosome [BR:dnv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108650745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 ig Ig_2 V-set
Motif
Other DBs
NCBI-GeneID: 108650745
NCBI-ProteinID: XP_017955503
UniProt: A0A484BXS0
Position
Unknown
AA seq 1441 aa AA seqDB search
MGNQPGKLQTPQSGRPKKNVHWKSAERPSPPGRPILTPLALSEQQPDVVNLRWERPQLDG
GSPIIGYTVEQRRVGSPHWVRATPTPISGCEIQISGLEPGWRYEFRCFAENIVGRSNASE
LSDPLTVTLQRNAITVPRFVEELTDMDAVEDERIEFRVRVLGEPPPEINWFKDGYEIFSS
RRTKIVNELDCSVLIIHQVALTDEGEIKCSATNRAGHVVTKCRLKVQAPPKIRLPRTYED
GLIVEAEEVLRLKVGVAGQPAPAITWLHEGEVIVPGNRFEITNTEKNSLLKIDNVQRADR
GEYMVRAWNKLGDDIASFLVTVTARPNPPGAPRLNMSFGKSATLSWTAPLDDGGCKIGNY
IVEYFRIGWNVWLKAATTRALSTTLHDLIEGSEYKFRVKAENPYGLSEPSEESELLFIPD
PKRGITKPKSASKIAGDERNDAGHKEKDKDISKPVPPRRKTLSPPRPQADAATSMSASPK
QSPRGSRKPTPQLVDSEQLRHEMSYGTSDQALKMSVRKSPSLSSADSAAVQTKTTKPDSN
PKLNLTLITTTALADKPEPQPKPPKSPPAAVPLKLFNVKPLATAKDKSPGRPVQKSKPQT
QPQPQPLPQPPTAALEPALDSSQRQPAPLRKSPTPPQPIKSTPALQRSAEPVQLGVNQNV
RRFSGHSLSPAKHVPALAIAIATTAHIGEPLPTIEISAPPPAEPELLVPATPTSEPTPPV
AKVRPPKPADKHDEVHTSNEFMLVVFDKNSKVKDKDKQDSFELELEDAIQPPPISISAPD
LAFLEFTNLHTTFPLRRSVSSTELLYERAMARFYEAVELEQAAKSKVKTAKAQEPAAIAV
TAPTTFRKRLGSMTEAERASFERRSELRRQSADMVPMGRKWDSRENINLVDLKNLTRANT
EQLLNLQARDTDGREQDMEEYDEDRTESTADDSEDLDMDEEQQQQQGFDLGTDYTESTAT
SDQDSIEKFKMQLMARTHSPSPRDLETYHPRNMSAGTFTPYRAPTPEQAAVVLNRPMPLP
SPDFVPKPILKRSSNEHVELTLSQPSSPDAQQQELGNGAVSSPSTPAAAPSNLKLDLAKG
IKSFFSRDKRSATEKNTEANEEISNPLEKTNAAAIAAELETKRKIKEEEELRRQEQERLM
QEEAHAAVDHYSDLVRQVSSTHKYHTPLYLDRDELKRAAAQAGEDDDDDDGAAAEHQQRR
ARSPDQDELLLAPPTVSRERRLSISEREQLVHVRDAASKHAMHKAPETPAYKDQREEEEP
EFPTVLVVPPPKSKNNKDAEECAESVMSEIVEARPDARGRTRLVKVKRVIKRRVPSSTRS
RDASLSRPQQPVAAGGSPMPQGHSSQASLLLSAADRELLEKAASLALLQSCSEEQAHEKV
RSALSYCTDLVLFLVACYVYLFKDARLVLPILALMIYRQLGEAVRSYIPSWLRRKGNDGG
A
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccaaccgggtaaactgcagacgccacagagtggacggcccaaaaagaatgtg
cattggaaatctgcagaacggccctctccgccgggtcgtcccatattaacgccgttggcg
ctctccgagcagcagcccgatgtggttaatctgcgctgggaacgcccgcagctggacggc
ggctcgcctattatcggctatacggtggaacagcgacgcgtcggctcgccccactgggtg
cgtgccacacccacgcccatctccggttgtgaaattcagatcagcggcctggagccgggc
tggcgctacgaatttcgttgctttgccgagaacattgtgggtcgctcgaatgccagcgag
ctgtccgatccgctgactgtgaccttgcagaggaacgcaatcaccgtgccacgctttgtg
gaggagctgacggacatggatgccgtcgaggatgagcgcatcgagttccgcgtgcgagtt
ctgggcgaaccgccgccagagatcaattggttcaaggatggctacgagatcttcagcagt
cgtcgcaccaaaattgtcaatgagctcgattgcagtgtgctgatcatacaccaggtggcg
ctgaccgacgagggcgagatcaagtgctcggccacgaatcgagcgggtcatgtggtcacc
aagtgtcgcctgaaagtacaggcaccgcccaagatccgtctgccgcgcacctacgaggat
ggcctcatcgtggaggcagaggaagtgctgcgtttgaaggtgggcgtggcgggacagcca
gcaccagccatcacctggctgcacgagggcgaggtcatagtgccgggcaatcgtttcgag
atcaccaacacggagaagaactcgctgctgaaaatcgacaacgtgcagcgcgcagatcgg
ggcgagtatatggtgcgcgcgtggaacaagctaggggacgatattgcctccttcctggtc
accgtgacagctaggccgaatccgccaggtgctccacgcctcaacatgtccttcggcaag
tcggccacgttgtcgtggacagctccgctggacgatggtggctgcaagatcggcaactat
atcgtggaatactttcgcattggctggaacgtttggctaaaggcagccaccacacgggcg
ctgagcaccaccttgcacgatctgattgagggctccgagtacaagtttcgcgtaaaggcg
gagaatccttacggcttgagtgagccatcggaggagtcggagttgctcttcatacccgat
cccaagcgtggcatcaccaagcccaagtcggcctccaaaatagctggcgatgagcgcaat
gacgctgggcataaggagaaggacaaggacatatcgaagcctgtgccgccgcgccgcaag
acgctgtcgccgccacgtccacaagcggatgcggcgaccagcatgtccgcttcgcccaag
caatcgccacgtggttcgcgcaagcccacgccacagctggtggacagcgagcagctgcgc
cacgagatgtcctacggcacctccgaccaggcgctgaaaatgagcgtgcgcaagagccca
tcgctaagcagcgccgactcggctgccgtgcaaaccaaaaccaccaagcccgactccaat
cccaagctcaatttgacgctgataacaacaacagcgctggcggataagccggagccccag
cccaagccaccaaagtcgcccccagctgcagtgccgctgaagctcttcaatgtcaagccg
ctggctacggccaaggacaagtcacctggtcgtccagtacagaagtcgaagccacagacg
cagccgcagccgcagccactgccgcaacctccgacagcagcactggagcctgccttggat
tcgtctcagcgtcagcctgcaccactgcgaaagagtcctacgccgccgcagcccatcaaa
tcgacgcccgccctgcagcgcagcgctgagcccgtccagctgggcgtcaatcagaatgtg
agacgcttctctgggcactccctgagcccggccaagcatgtgccggccttagcgattgcc
atagccaccactgcccacattggcgaaccgttgcccaccatagagatcagtgccccgcct
cctgccgagcctgagctacttgtgccggccactcccacatcggagccgacgccaccagtg
gcaaaggtgcgtccaccgaagccagcggataaacacgacgaagtccatacgagcaatgag
ttcatgctagtggtcttcgacaagaatagcaaggtcaaggataaggacaagcaagattcc
tttgagctggaactggaggacgccatacagccaccgccgatctccatctctgcaccggat
ttggccttcttggagttcaccaatttgcacacgactttcccgctgcgccgctcggtcagc
tccacggagctgctctacgagcgtgccatggcgcgcttctacgaagccgtggaattggag
caagccgccaaatcgaaggtgaagactgcgaaggcccaggagccggcagccatagccgtg
accgctccgactacgttccgcaagcgcctgggctctatgacggaggcggagcgtgcttcc
tttgagcgccgcagcgagctgagacgccagtcggctgacatggtgcccatgggacgtaaa
tgggattcacgggagaacatcaacctcgttgacttaaagaatttgacacgtgccaacacg
gagcagttgctcaatctgcaggcaagagacactgatggtcgcgaacaggatatggaggag
tatgacgaggatcgcacggagagcacagccgatgacagcgaggatttggatatggacgag
gagcagcagcagcagcagggcttcgacctgggcactgattataccgagagcaccgccacc
tccgaccaggactccattgagaaattcaaaatgcagctaatggctcgcactcactcacct
agtccacgtgacctggagacgtatcatccgcgcaacatgagcgccggaaccttcaccccg
taccgtgcacccacgccggagcaggcagctgtggtgctcaatcggccaatgcctctgccc
agtccggactttgtgccaaagcccatactgaaacggtcatccaatgagcacgtcgagctt
acccttagccagcctagcagcccggatgcacagcaacaggagctgggaaatggcgctgtc
agcagcccttccactcctgctgcagcacccagtaatttgaaactggatctggccaagggc
attaagtcctttttcagccgggacaagcggtcggccaccgagaagaacaccgaggccaac
gaggagatctcgaatccactggagaagaccaacgctgcagccatcgctgcagagctggag
acgaaacgcaagataaaagaggaggaggagttgcggcgccaggagcaggaacgactgatg
caggaggaggcccacgcagccgtggatcactacagcgatctggtgcgccaggtgagcagc
acccacaagtaccacacgccgctctacctcgaccgagacgaactgaagcgagccgctgcc
caggcgggggaggatgacgacgacgacgatggtgctgcagcggagcatcagcagcgtcga
gcacgcagtcccgatcaggatgaactgctgctggctccgcccaccgtcagtcgggagcga
cgtctgtccatttcagagcgggagcagcttgtacatgtgcgtgacgcagccagcaaacat
gccatgcacaaggcgcctgagacacctgcatataaggatcagcgggaggaggaggagccg
gagtttcccactgtgctggtggtgccgccacccaagtccaagaacaataaagacgccgag
gagtgcgccgagagtgtgatgagcgaaatagtagaggcgcgccccgatgctcgtggacgc
acgcgtctggtgaaggtcaagcgtgtgatcaagcgccgtgtgccttccagcacgcgctcc
cgcgatgcctcgctgagcaggccacagcagccggtcgcagccggtggtagtcctatgccc
caggggcacagctcgcaagcgtcattgctgctgtccgccgcggatcgtgagctgttggag
aaggcggccagcttggcgctgctgcagtcctgttccgaggagcaggcgcacgagaaggtg
cgctccgcattgagctactgcacggatctggtgctcttcctcgtagcctgctatgtctat
ctgttcaaggacgcacgcctcgtcctgcccatcttggcgctgatgatctatcgccagctg
ggcgaggccgtgcgtagctacatccccagctggctgcgacgcaaaggcaacgatggcggt
gcctga

DBGET integrated database retrieval system