KEGG   Drosophila navojoa: 108651051Help
Entry
108651051         CDS       T05898                                 

Definition
(RefSeq) separin isoform X1
  KO
K02365  separase [EC:3.4.22.49]
Organism
dnv  Drosophila navojoa
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dnv01002]
    108651051
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dnv03036]
    108651051
Enzymes [BR:dnv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     108651051
Peptidases and inhibitors [BR:dnv01002]
 Cysteine peptidases
  Family C50: separase family
   108651051
Chromosome and associated proteins [BR:dnv03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    108651051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 DUF5600
Motif
Other DBs
NCBI-GeneID: 108651051
NCBI-ProteinID: XP_017955965
Position
Unknown
AA seq 639 aa AA seqDB search
MFDAEATEKELRSLTSVQVGPETKEYNLLRADEEYRNGNEKDSIYYQVRALFQCADMRLL
TEAQELENQLPNASEILLEATPKEKADYKRNKFLQNILNYQLKLEERTTTPKNTVIDSLD
FLQDVQDPKLGYARITEVCQQLPEEWCVLQLCKSFNAATTYSTFCEIAAANGDIYVSLLR
HCRSPELEPTCLHFNNDALGSLFKEYSTMVERFRRVVTVDPLAVKDQESKAKYWKELHAF
EDYLKKLIADLNSVFMPYCFMFLGKRYADAAVQQQTKLIFDRVDEFCVEHRWNNHQRILL
SQAALHANRLPHDQMKQLSYELNSNSNNNNNETEALLVYELLKSCATKWQKLEQRQQLAA
KRFPIILVVDERLDHMHWEQLAPMQECTRIKSLHSLWRLFKYHKAKIQHGYYMVDIKKGI
TLINPDADLQNSGRRLRSFLEYWLSHWQHMFETVPTEQFMIEKAFKADCFVYAGHGSSLQ
YVSSRLIYRNRIQGVIFLFGCDSTRVLSSGLYSALYGAQDYYHGALCPTVVGTLMPALDG
NMDNVSANILSQWIAPVEKQIIPWTSIDRAAWVSQGTVKAALKGNSDTLEQHLDYHTGSL
SAILANVQMGKVEPKIYNCCVYVCRGLPVWNAAVEELPF
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgccgaagcaacagaaaaagaattgcgtagcttaacaagtgtgcaagttgga
cccgaaaccaaagaatataatttattgcgtgcggacgaagaatatcgcaatggcaatgaa
aaggattcgatttattatcaagttagagcactatttcagtgcgcagatatgcgactccta
accgaggcccaggagctggaaaaccagctgccgaacgcttccgaaatattgttggaagcg
actcccaaggaaaaagcagactacaaaaggaacaaatttctgcagaacatattaaattac
caattgaaattggaggaacgcacaacaacgcctaaaaacacagtcatcgatagcttggac
tttctgcaggacgtgcaggatccaaagttgggctatgcacgcatcacagaggtctgccaa
caactgccagaggagtggtgtgtgctgcagctctgcaagagcttcaatgcggccaccact
tactccaccttttgtgagatcgctgccgccaatggcgacatttatgtttctcttctacgg
cactgtcgcagtccagagctcgagcccacttgcctgcacttcaataacgatgcgctgggt
agcttgtttaaggagtacagcactatggtggagcgatttcggcgagtggtcacagtcgat
ccgctggcggtaaaggatcaagagtccaaggctaaatactggaaagagttgcatgccttc
gaagactacttaaagaaactaattgccgatctgaacagcgtattcatgccctactgtttc
atgtttctgggcaagcgctatgccgatgctgcagtgcaacagcaaaccaaattgattttt
gatcgcgttgatgagttctgcgtggagcacaggtggaacaatcatcagcgtatattgctc
tcacaggcggcgctgcatgcgaatcgtttgccacacgaccagatgaaacagctgagctat
gagctaaacagcaacagcaacaacaataacaatgagactgaggcgctgctcgtctacgag
ctgctcaagagctgtgccactaaatggcagaaactcgagcagcgtcaacagctggctgcg
aaacgctttcccatcatactggttgtagatgagcgcctggatcatatgcattgggagcag
ttggcgcccatgcaggagtgcacgcgcatcaaatcgctgcacagtttgtggcgcctgttc
aagtaccacaaggcaaagattcagcacggttactatatggtcgacattaagaaaggcata
acactcattaatcccgatgctgatctgcaaaattcgggccgtcgtctgcgcagctttctc
gaatactggctcagccactggcagcatatgttcgagacggtgcccacggagcagtttatg
attgaaaaggctttcaaggccgattgttttgtctatgcgggtcacggctcgagtctgcaa
tatgtttccagtcgcctgatttatcgcaatcgcatccagggtgtcatctttcttttcggc
tgcgactcgacgcgcgtgctgagctcgggtctgtacagtgccttatacggagcacaggac
tactaccatggcgcgctctgtcccactgtggtgggcacattgatgcccgcactggatggc
aatatggataatgtgtccgccaatatactgagccagtggatagcaccggtcgagaaacag
atcataccctggacaagcattgatcgcgcggcttgggtctcgcagggcactgtcaaagca
gcactcaaagggaacagcgatactctggagcagcacctggactatcatacgggcagtcta
agcgccattttggccaatgtgcaaatgggcaaagtggagccgaaaatctacaattgctgt
gtctacgtgtgccgcggtttgccggtctggaatgcagctgtggaagagctacccttttaa

DBGET integrated database retrieval system