KEGG   Drosophila navojoa: 108651102Help
Entry
108651102         CDS       T05898                                 

Definition
(RefSeq) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
dnv  Drosophila navojoa
Pathway
dnv00051  Fructose and mannose metabolism
dnv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    108651102
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnv04147]
    108651102
Enzymes [BR:dnv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     108651102
Exosome [BR:dnv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108651102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 108651102
NCBI-ProteinID: XP_017956048
Position
4
AA seq 309 aa AA seqDB search
MTTAKPVLCVGCTVIDFVTINESFPTEDTDRRCLDGYWQRGGNASNVSTVLRLLGANVEF
FGMLSRSNGFRVLLDDLDRRGIGTQHCPKTEKDPPFSSVIIVKKTGSRTIVHCNKNYPYI
TYEDFMNIKLDRYGWVHFEARHAHETIKMIKAVQEHNRIQGSNIRISLDFETTFEENLPL
CGLCNYIVFSSELAKQKGWKSSQETCYALASNVEPTCPSIICPWGSTGAACLDTAINECT
NVPALRPDRIVDTLGAGDSFMAGFIYATYVMQCNLPDAVGFANRVAGHKIMDFGYDHIAG
LQKDKLTTD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagcgaagcccgtgctctgtgtgggctgcaccgtaattgactttgtgacaatc
aatgaaagtttccctacggaggacacggataggcgatgcctcgacggatattggcagcga
ggagggaatgcctctaacgttagcaccgtgcttcgattgctgggcgcgaatgtcgaattc
ttcggcatgctcagtagatcaaacggcttcagagtactattggacgatttggatcgacgt
ggcattggcacacagcactgtcccaaaacggagaaagatccgccgttctcctcagtgata
attgtcaagaagaccggctcgcgaaccattgtgcattgcaataaaaactatccgtatata
acgtatgaagactttatgaatataaaactggatcgctacggttgggttcacttcgaggca
cgtcatgcccacgaaacaatcaaaatgataaaagccgtgcaggagcacaatcgaatccag
ggctctaacatccgtatctccctagattttgagacaacgtttgaggaaaacctaccactg
tgcggcctttgtaattatattgtgttttccagcgagctggccaagcagaagggctggaag
agttcccaagaaacttgctatgctcttgctagcaacgtagaacccacatgtcctagcata
atttgtccttggggcagcacgggtgctgcttgtctggatacagctatcaatgagtgcacc
aatgtaccggccctcaggcctgatcgtatcgtggatacccttggtgccggtgacagcttt
atggctggcttcatatacgctacctacgtaatgcagtgtaacctgccggatgctgtaggc
ttcgctaatcgcgtggcgggtcacaagatcatggatttcggatacgatcatattgcgggg
ctacagaaagacaagcttacaacggattga

DBGET integrated database retrieval system