KEGG   Drosophila navojoa: 108651474Help
Entry
108651474         CDS       T05898                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha isoform X2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
dnv  Drosophila navojoa
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnv04147]
    108651474
Enzymes [BR:dnv01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     108651474
Exosome [BR:dnv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108651474
  Exosomal proteins of other body fluids (saliva and urine)
   108651474
  Exosomal proteins of colorectal cancer cells
   108651474
  Exosomal proteins of bladder cancer cells
   108651474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Cation_efflux HAD SfLAP
Motif
Other DBs
NCBI-GeneID: 108651474
NCBI-ProteinID: XP_017956699
Position
Unknown
AA seq 1043 aa AA seqDB search
MALRSDYEPHLERADSYRVATVIATDDDNRTADGHFKSRRKMPAKAAKKENLDDLKQELD
IDHHKISPEEMYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGF
AMLLWIGAILCFVAYSIQATTSEEPSDDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMES
FKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTG
ESEPQSRGSEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTG
ETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATV
TVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEA
DTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCM
ELALGDVMNIRKRNRKIAEVPFNSTNKYQVSIHETEDANDPRVLLVMKGAPERILERCST
IFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDYMLPSDKYPTGYKYNTDDINFPI
DNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNET
IEDIAQRLNIPISEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLI
IVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVT
GVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAI
SLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLP
MKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTR
RNSIFHQGMRNWALNFGLVFETVLAAFLSYCPGMDKGLRMYPLKLVWWFPAIPFMLAIFV
YDETRRFYLRRNPGGWLEQETYY
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaaggtcggattacgagccgcatttagagagagcggactcctatcgagtcgcc
acggttattgcaaccgatgacgacaatcgcacagccgatggccacttcaagtcaagacgc
aagatgccggccaaagcagctaagaaggagaacttggatgatctcaaacaggagttggat
attgaccatcataaaatctctcctgaggaaatgtaccagcgtttccagacacatcccgaa
aatggtctgagtcatgccaaggctaaggagaatctggaacgtgatggccccaatgcgcta
acaccgcccaagcaaacgcccgaatgggtgaagttctgcaagaatctgtttggcggcttt
gccatgctgctgtggatcggtgctatactgtgctttgtcgcctactccattcaggcgaca
accagcgaggagccatccgacgataacttgtatctgggtattgtactttccgctgtggtc
attgtgacaggcattttctcatactaccaggaatcgaaaagttcgaaaattatggaatcg
ttcaagaacatggtgccccagttcgctactgttattcgtgagggcgagaaattgacgctg
cgcgccgaggatctcgtcttgggcgatgttgttgaggtgaagttcggcgatcgtattccc
gccgacattcgcatcattgaggcgcgcaactttaaggtggataactcttcgctaactggt
gaatcggagccgcagtcgcgtggctcggagttcacgcacgagaaccccttggagaccaaa
aacttggccttcttctcgaccaatgccgtcgagggcactgccaagggcgttgtcatcagc
tgcggcgatcacactgtcatgggtcgcattgctggcctggcttccggtctggataccggc
gagactcccattgctaaggaaatccatcatttcatccatttgatcaccggcgttgctgtg
ttcctcggcgtcaccttctttgtgattgccttcatcttgggctaccattggttggacgcc
gtcatctttttgatcggtatcattgtcgccaacgtgccggagggtctgctggccactgtc
accgtgtgcctgaccctgactgccaagcgtatggcatcgaagaattgtttggtcaagaac
ctggaagctgtcgaaacgttgggctccacctccaccatctgctctgataagaccggcaca
ctcacccaaaaccgcatgacagtcgcccatatgtggttcgataaccagatcattgaggcc
gataccactgaggatcagtcgggtgttcaatacgatagaaccagccctggattcaaggcg
ctctctcgcattgccactctctgtaaccgtgccgagttcaaaggtggtcaggatggtgtc
ccaattctgaagaaggaggtcagcggcgatgcctccgaggctgctctgctcaagtgcatg
gaactggctctcggcgatgtgatgaacattcgcaagcgcaaccgcaaaatcgccgaagtg
ccgttcaactccaccaacaagtatcaagtgtccattcacgagaccgaggatgccaacgat
ccacgtgtgctgctggtgatgaagggcgcacccgagcgtattctggagcgctgctcgacc
atctttatcaacggcaaggagaaggtgttggacgaggagatgaaggaggcgttcaacaat
gcctacatggagctcggtggactcggcgagcgtgtgctcggcttctgtgattacatgctg
ccctccgataagtacccaactggctacaagtacaacaccgacgacatcaacttccccatt
gacaatctgcgtttcgttggcctaatgtccatgattgatcccccacgtgccgctgtgccc
gatgccgtggccaagtgccgttcggccggcatcaaggtcatcatggtcactggcgatcat
ccaattactgccaaagccattgccaaatctgtcggcatcatctccgagggcaacgagacc
atcgaggatattgcccagcgtctcaacatacccatctctgaggtcaatccgcgcgaggcc
aaggctgctgtggtccatggcgccgagctgcgtgacgtgtcctccgatcagctggatgaa
atccttcgctatcacaccgaaattgtctttgcccgcacctcgccccagcagaagctcatt
attgttgagggttgccagcgcatgggcgccattgtggctgtcaccggtgacggtgtcaac
gattcgcctgccctgaagaaggccgacattggtgttgctatgggcattgctggctccgat
gtgtccaagcaggccgctgacatgatcttgttggacgataactttgcctccattgtcact
ggcgttgaggagggtcgcttgatctttgataatttgaagaagtccattgcctacacactc
acctccaacatacccgagatttcgcccttcttggccttcattctgtgcgatataccactg
ccactcggtaccgtcacaattctgtgcatcgacttgggcactgacatggtgccagccatt
tcattggcctacgaacatgccgaagccgatattatgaagcgtccgccacgtgacccattc
aacgataaattagtgaactcaagattgatttccatggcctatggacaaattggcatgatc
caggcagcagccggtttctttgtctactttgtgattatggctgagaacggtttcctgccc
atgaaactgtttggcattcgtaagatgtgggactccaaggccgtcaacgatctaactgac
tcctatggtcaggaatggacttatcgcgatcgcaagaccttggaatacacctgccacacc
gcgttcttcatttcgattgttgtggtacagtgggccgatttgatcatttgcaagacgcgt
cgcaactccatattccaccagggcatgcgcaactgggccctcaactttggcctcgtcttc
gaaacggtgctggctgccttcctctcctactgccccggcatggacaagggtctgcgcatg
tatcccctgaaactcgtctggtggttcccagccattccattcatgttggccatctttgtg
tatgatgagactcgtcgtttctatttgcgtcgcaaccccggcggctggttggagcaggag
acatactattaa

DBGET integrated database retrieval system