KEGG   Drosophila navojoa: 108653569Help
Entry
108653569         CDS       T05898                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dnv  Drosophila navojoa
Pathway
dnv03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108653569
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dnv03041]
    108653569
Enzymes [BR:dnv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108653569
Spliceosome [BR:dnv03041]
 Complex C
  Other components
   Step II factors
    108653569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 Flavi_DEAD AAA
Motif
Other DBs
NCBI-GeneID: 108653569
NCBI-ProteinID: XP_017959669
UniProt: A0A484BK09
Position
Unknown
AA seq 1288 aa AA seqDB search
MDELQKLEYLSLVSKICTELDNHLGINDKDLAEFIIDLEHKNRSYDAFRKALLENGAEFP
DSLVQNLQRIINLMRPSRPEYDAKITAGEDSKEDKKSQLKKMFPGLALPNDKFSCKMDED
EQNKEKESKQKLAINKNDMSDVDAAMLELEALEPGERKEESVKENSRSSRDRHKRKERSR
SRERDRDRNRDRDRKRESDRHREREKDNQRERERERDRERDKEHRRRRSRSREERDRDRD
RDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDHDRDHRKRRSSSRERQDRHEQRRRRSRS
RSPERSTRNQQQEKMPPPATGMSDDPEVGKIYSGKVANIVPFGCFVQLFGVRKRWEGLVH
ISQLRAEGRVTDVTEVVARNQTVKVKVMSLAGQKVSLSMKEVDQETGRDLNPLSHAPEED
ELTLRDRNPDGPYNSTSSMLNLQGNNIDGDEHESRKRVTRISSPERWEIKQMISSGVLDR
SEMPDFDEETGLLPKDEDDEADIEIEIVEEEPPFLSGHGRALHDLSPVRIVKNPDGSLAQ
AAMMQSALSKERREQKMLQREQEMEAVPSNLNKNWIDPLPEDDSSRHLAANMRGMGAAPQ
EVPEWKKHVIGGKKSSFGKKTDLTLIEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSG
KTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTS
PETVIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKL
IVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPP
GDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSR
KVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGR
TGPGKCYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVES
LVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLS
VQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLK
RSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVV
YIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFK
KNQRLEPLYNKYEEPNAWRISRVRRRRN
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atggacgaattgcagaagctggaatacttgtccctggtgtcaaaaatctgcacggagctt
gacaatcacttgggaattaatgacaaggatttagctgaattcatcatcgatttggaacac
aaaaatcgcagctacgatgcgtttcgcaaggcgctactggaaaacggggccgagtttccc
gattctctggtgcaaaacttgcagcgaattatcaatttaatgcgacccagtagacctgaa
tacgatgcaaaaattacggctggcgaggatagcaaggaagataaaaaatcgcagctaaag
aaaatgtttcccggcttagctctacccaatgacaaattcagctgcaaaatggacgaggac
gaacagaataaagaaaaagagtcaaagcagaagttggcaataaataagaacgatatgagc
gacgttgatgccgccatgctggagctagaggctctggaacctggcgagcgaaaagaggag
tcagtaaaagagaacagtaggagctcacgggaccgccacaaacgcaaagaacgcagtcga
agtcgcgagagagaccgtgatcggaatcgagacagggatcgaaagagggagagtgatcgg
catagagaacgagaaaaggataatcagagagaaagagaacgagaaagggatagagaacgg
gataaggaacatcgtcggcggcgcagcagatctcgagaagaacgcgatcgcgatcgtgac
cgcgaccgtgatcgtgaccgtgatcgtgaccgcgaccgtgatcgtgatcgtgaccgcgac
cgtgatcgtgatcgtgaccgcgaccgtgatcgtgaccatgaccgtgaccatcgcaaacgc
cgctctagctcacgagagcggcaggacagacacgagcaacgtagacgacgctcccgttcc
cgatctcctgaacgcagcacccgcaatcagcagcaggagaaaatgccaccgccagcaact
gggatgagcgatgatccagaggtgggcaagatttactccggcaaggtggcgaacatagtc
ccatttggttgcttcgtgcagctatttggtgtgcgcaagcgttgggagggtctggtacac
atctcgcagctacgcgccgagggacgtgtcaccgatgtgactgaggtggtggcacgaaat
cagacagtaaaagtgaaggtcatgtcgctagcgggtcaaaaagtatcactgtcaatgaag
gaggtggatcaagaaactgggcgcgatctcaatccattgtcacatgcacccgaggaggat
gaattgacattgcgggatcgaaatcctgatggaccttacaacagcacctcctccatgcta
aatctgcagggcaacaacattgatggcgatgagcacgagtcacgcaagcgagtgacgcgc
atctccagtccagagcgatgggaaatcaagcaaatgatcagctcgggtgtgctggaccgt
agtgaaatgcccgatttcgatgaagagacaggccttttgcccaaggatgaggacgacgag
gcggacattgaaatagaaatcgtagaagaggagccacccttcctctccgggcatggacga
gcattgcatgacttgtctcccgtgcgaatagttaaaaatccagatggctcgcttgcccaa
gcagcgatgatgcagtccgctttgtctaaagagcggcgtgagcagaaaatgttgcagcgg
gagcaggagatggaagcagtgcctagcaatctcaacaagaactggatcgatccgctaccc
gaagatgattcttcacgccacctggcggccaatatgcgcggtatgggtgctgctccacaa
gaggtacccgagtggaagaagcacgtcatcggtggcaagaaatcttcctttggcaaaaag
accgatctgactctcatcgagcaacgccaatctcttcccatttacaagctccgtgacgat
ctcatcaaggccgtcacggataaccagattctgattgtaattggcgagacggggtccggc
aagaccacacagatcacgcagtatctgggcgagtgtgggttcacggccaggggcaagatt
ggatgcacccaaccacgtcgtgtggctgccatgtccgtggctaagcgagtggccgaggag
tttggctgtcgcctgggccaggaggtgggctatacaatacgttttgaagactgtaccagc
ccggagacagtaatcaagtacatgacggacggcatgttgttgcgcgagtgcctaatggag
gcggagcttaagtcgtattctgtcatcatgttggatgaggctcacgagcgcacgatccac
acggatgtgctttttggactgctgaaaacagccgtacaaaagcgtcctgaattgaagctg
attgtcacctcggccacgttggatgcggtcaagttttcgcagtatttctttgaagcccct
atttttacgatacccggacgcacgtttcccgtggaggtgttgtatactaaggagccagag
acggactatttggacgcttcgctcataactgtgatgcaaatccatttacgtgaaccgcct
ggcgacatactgctcttcctaacgggtcaggaggagattgacaccgcctgtgagatactc
tacgagcgcatgaaaagcttgggtccagatgtgcccgagctaatcatattgcctgtgtat
tcggctcttccctccgagatgcagacccgaatctttgatccagcgccggcgggcagtcgc
aaagtggtgattgccacaaatatagctgaaacatcgctcactatcgatggcatcttctat
gtggttgatcccggctttgtaaaacagaaggtttacaattccaagacgggcatggattcc
ctagtggttacgcccatctcccaggccgctgccaaacaacgtgccggccgtgctggacgt
acgggacctgggaaatgttatcgcctttatacggagcgtgcctatcgggatgagatgctg
ccaacgcctgtgccggagatccaacgtacgaatcttgcaacaacagtgttgcagctgaaa
acaatgggcatcaatgacttgctgcattttgattttatggatgcccctcccgtggagtca
ttggtcatggcattggaacagctgcattcgctctctgcgctcgatgacgagggtttattg
acacgccttggtcgtcgtatggcagagtttcctctcgagccaaatctatcgaaaatgctc
atcatgtctgtcgcactgcagtgctcggatgagatcctcaccattgtatctatgctcagc
gtacagaacgtgttctacagacccaaggataagcaggcgctggccgatcaaaaaaaggcc
aagtttaaccaagcagagggtgatcatctaactctgttggcggtctataatagctggaag
aacaacaagttctcgaatgcctggtgttatgagaatttcgtgcaaatccgtacactgaaa
cgttcccaggatgtgcggaagcaactgctcggcatcatggatcgccataagctggacgtt
gtttctgcgggaaaaaattcggtgcgcatacaaaaggccatatgttctggcttctttcgt
aatgcggccaaaaaagatccacaagaaggctatcggaccctggtcgattcacaagtggtt
tatatacatccttcaagcgcgctattcaatcggcaacccgaatgggttatctaccatgag
ctggtgcaaacgacaaaagagtatatgcgtgaggtaactaccattgatcctaaatggttg
gtggagtttgcgccatcctttttccgcttctctgatcccaccaagctcagtaaattcaag
aagaatcaacgattggagccgctgtacaacaagtacgaggagccaaacgcgtggcgtata
tcacgcgtacgtcgccgccgtaattaa

DBGET integrated database retrieval system