KEGG   Drosophila navojoa: 108655595Help
Entry
108655595         CDS       T05898                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dnv  Drosophila navojoa
Pathway
dnv00010  Glycolysis / Gluconeogenesis
dnv00562  Inositol phosphate metabolism
dnv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108655595
   00562 Inositol phosphate metabolism
    108655595
Enzymes [BR:dnv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108655595
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108655595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Thioredoxin_7
Motif
Other DBs
NCBI-GeneID: 108655595
NCBI-ProteinID: XP_017962851
Position
X
AA seq 222 aa AA seqDB search
MFYARSFNAEPAMQSAVSHVRAVTKIMDLTTQDVQLMYTVCAFETAWQRRLPPSVWCRFF
DVASLSALEFAEDLEYYWNDGYGYELTHRIACPAIADMFAAIDTLKPRANATFYFTHSGT
LLKMLAHLGVAKDERPLTHKDFETKRLWRTSEIDAFATNLAFVRYDCTEREPQILAMHQE
RVIRLPGCPQDDDLCPLSRLRANYVDSVERCDFEALCSQAAN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttttatgcacgtagcttcaacgcggagcccgcaatgcagtcagcagtgtcgcatgtg
cgtgccgttaccaaaataatggacttgaccacccaggatgtccagctaatgtataccgtg
tgcgccttcgagacggcctggcaacgccgtctgcccccatccgtctggtgtcgcttcttc
gatgtggcctcattgagcgccttggaattcgctgaggatctcgagtactattggaacgat
ggctatggctatgaattgacgcatcgcattgcctgtccggcaatcgcagacatgtttgcg
gccatcgacacactgaagccacgcgccaatgccaccttctactttacccattcgggaacg
ctgctcaagatgctggcccacctgggcgtggccaaggacgaacgtccgctgacgcacaag
gatttcgagacgaagcgtctgtggcgcacaagtgaaatcgatgcgttcgcaaccaacttg
gcttttgtgcgctatgattgcactgaaagggagccgcaaattttggcaatgcatcaggag
cgggtgattcgtctgcccggctgtccgcaggatgacgatctttgtccgctttcgcggctg
cgggccaactacgtggatagcgtcgagcgctgtgactttgaggcgctctgcagccaagca
gccaattga

DBGET integrated database retrieval system