KEGG   Drosophila navojoa: 108656856Help
Entry
108656856         CDS       T05898                                 

Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
dnv  Drosophila navojoa
Pathway
dnv03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    108656856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dnv03011]
    108656856
Ribosome [BR:dnv03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    108656856
  Bacteria
    108656856
  Archaea
    108656856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22 K-box
Motif
Other DBs
NCBI-GeneID: 108656856
NCBI-ProteinID: XP_017964664
UniProt: A0A484B445
Position
Unknown
AA seq 231 aa AA seqDB search
MHKMIRRMAQLTVQTPLLAAAPVTGAAKLLATPPAITQNVDCCGVHTAASGGLCTKWNKH
NYGPRKWLEYNKTVHPPQEVDEEPRKAYVCHMRTNIKYSPDKMWYIAAFVRGMSVDEALK
QLNFVLKKGATDVRETILEAQQMAVERHNVEYKSNLWIAESFVGKGRVFKGMRRHARGRF
GRVEYKHCHYFLRLEEGEPPQHYYLPEPQTPEQQLEQWLEQMRSRKIISSL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaatgataaggcgaatggcgcagctaacggtgcaaacgccgctgcttgcggct
gcccccgtaaccggcgcagccaaattgttagccacgccgcctgcgatcacgcaaaacgtt
gactgctgcggcgtgcacacggctgcctctgggggcctctgcaccaaatggaataaacac
aattacgggcctcgcaaatggctggaatacaacaaaacagtgcatccgccacaggaagtg
gacgaggagccacgcaaagcgtatgtgtgccatatgcgcaccaacatcaaatatagtccg
gacaagatgtggtatatagcggcctttgtgcggggcatgtccgtagacgaggcgctcaag
caactgaattttgtgctcaaaaagggagccacagatgtcagagagacgatattggaggct
cagcaaatggccgttgagcggcacaatgttgagtataaaagcaatttgtggattgctgaa
tcctttgtgggcaagggacgtgtcttcaagggaatgcgacgacatgcgcgcggtcgcttt
ggacgcgttgagtacaagcactgtcactacttcctgcggctagaagagggcgaaccaccg
cagcactactacctacccgagccacagacgcctgagcaacagttggagcaatggttggag
caaatgcgcagtcgaaaaatcatcagttcgttgtag

DBGET integrated database retrieval system