KEGG   Drosophila navojoa: 108658722Help
Entry
108658722         CDS       T05898                                 

Definition
(RefSeq) heat shock protein 68
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dnv  Drosophila navojoa
Pathway
dnv03040  Spliceosome
dnv04141  Protein processing in endoplasmic reticulum
dnv04144  Endocytosis
dnv04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108658722
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108658722
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108658722
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108658722
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dnv01009]
    108658722
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dnv03041]
    108658722
   03009 Ribosome biogenesis [BR:dnv03009]
    108658722
   03110 Chaperones and folding catalysts [BR:dnv03110]
    108658722
   04131 Membrane trafficking [BR:dnv04131]
    108658722
   03051 Proteasome [BR:dnv03051]
    108658722
   03029 Mitochondrial biogenesis [BR:dnv03029]
    108658722
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnv04147]
    108658722
Protein phosphatases and associated proteins [BR:dnv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108658722
Spliceosome [BR:dnv03041]
 Complex B
  Other components
   Prp19 complex
    108658722
 Complex C
   Prp19-CDC5 complex
    108658722
Ribosome biogenesis [BR:dnv03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108658722
Chaperones and folding catalysts [BR:dnv03110]
 Heat shock proteins
  HSP70 / DNAK
   108658722
Membrane trafficking [BR:dnv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108658722
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108658722
Proteasome [BR:dnv03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108658722
Mitochondrial biogenesis [BR:dnv03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108658722
Exosome [BR:dnv04147]
 Exosomal proteins
  Proteins found in most exosomes
   108658722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A StbA DUF1843
Motif
Other DBs
NCBI-GeneID: 108658722
NCBI-ProteinID: XP_030241809
Position
Unknown
AA seq 640 aa AA seqDB search
MPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP
SNTVFDAKRLIGRKYDDPKIQGDMKHWPFKVVNDCGKPKISVEFKGEQKRFAPEEISSMV
LVKMKETAEAYLGTTIKDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAY
GLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLA
DEFKRKFKKDLRSNPRALRRLRTAAERAKRTLSSSSEATIEIDALFEGHDFYTRVSRARF
EELCADLFRGTLQPVEKALNDAKMDKSQIHDIVLVGGSTRIPKVQSLLQNFFSGKNLNLS
INPDEAVAYGAAIQAAILSGDQSSQIKDVLLVDVAPLSLGIETAGGVMTKLIERNSRIPC
KQSKTFTTYADNQPAVTIQVFEGERAMTKDNNVLGTFNLTGIPPAPRGVPKVEVTFDLDA
NGILNVTAKEMSTGNAKNITIKNDKGRLSQADIDRMVSEAEQYAEEDEKHRQRIAARNQL
ESYVFGVKEAAENAKDKISQSERSTVLDTCSEAIKWLDANTTADKEEYEYKLQELTKVCS
PVMTKMHQAAGGGDGPQASHCGQQAKGCNGSGGPTIEEVD
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaattggtattgacttgggcaccacctactcctgtgttggtgttttccagcac
ggcaaagtggagataatagccaacgaccagggcaaccgcaccacacccagctatgtggca
tttaccgactcggagaggttgattggagacgcggccaagaaccaagtggccatgaatcca
agcaacactgtcttcgatgcgaagcgtttgattggccgtaaatatgatgatccgaagatt
cagggtgacatgaagcactggccattcaaagtggtcaacgactgcggaaaaccaaagata
agtgtcgagttcaagggtgaacagaagcgcttcgcgccggaggagatcagctcgatggtt
ctggtaaagatgaaggagacagccgaagcttacttgggcaccaccatcaaagacgccgtc
atcactgtgcctgcctacttcaatgactcacagcgtcaagcaaccaaagacgctggtgcc
atcgccgggctgaacgtgctgcgcatcatcaatgagcccactgcagccgctctggcctat
ggcttggacaagaacctcaaaggcgaacgcaacgttctaatattcgacttgggtggcggc
accttcgatgtgtccatcctgaccatcgacgagggctctctgttcgaagtgagagccact
gctggagatactcatctgggcggagaggactttgacaacagattggtcaaccatttggca
gatgagtttaagcgcaaatttaaaaaggatctgcgctccaatccacgagcgctgcgtcgg
ctgcgcactgcagctgagagggcaaagcgcacattgtcgtcaagcagcgaagctaccatc
gagatcgacgcgttgtttgagggccatgacttctacacaagggttagccgagcgcgcttc
gaggagctgtgcgccgacctgttccgcggcaccctgcagcctgtggagaaggctctgaat
gatgccaagatggacaagagccagattcacgacatcgtcttggttggcggctcaacacgt
attccgaaggtgcagagcttgctgcagaacttcttctcaggaaagaacctcaacctgtcc
atcaatccggacgaggcggtggcctacggagccgccattcaagctgccatacttagtgga
gaccagagcagccagatcaaggacgtgctgctggtggatgttgcgccgctatcactgggc
atagagacagctggaggagtgatgacgaaactgattgagcgcaacagccgcattccttgc
aagcagtcgaagacctttaccacatacgcagacaaccagcccgccgtgacaattcaggtg
tttgagggcgagcgcgccatgacaaaggacaacaacgtgctgggcactttcaatctgacc
ggcattccaccagctccgcgcggtgtgccaaaggtggaagttaccttcgatctggacgcc
aacggcatattgaatgtgacagccaaggagatgagcactggcaatgcaaagaacataacc
atcaagaacgacaagggacgtctctcgcaagccgacatcgatcgcatggtgagcgaggcc
gagcagtatgccgaggaggacgagaagcatcgccagaggattgctgctcgcaaccagctg
gagagctacgtctttggcgtgaaggaagctgccgaaaacgctaaagacaagatttcgcag
tctgagcgaagtaccgtgctggacacgtgcagcgaagcaatcaagtggctcgacgctaat
accacagccgacaaggaggagtatgagtacaagctgcaggaactcacaaaagtctgcagt
cctgtgatgacgaaaatgcatcaggcagctggaggcggcgatggtccacaagcttcccac
tgtggccaacaagctaaaggctgcaatggtagcggtggccccaccattgaggaggttgat
taa

DBGET integrated database retrieval system