KEGG   Drosophila navojoa: 108659853Help
Entry
108659853         CDS       T05898                                 

Definition
(RefSeq) uncharacterized protein LOC108659853
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dnv  Drosophila navojoa
Pathway
dnv00260  Glycine, serine and threonine metabolism
dnv01100  Metabolic pathways
dnv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    108659853
Enzymes [BR:dnv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     108659853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 108659853
NCBI-ProteinID: XP_017968477
UniProt: A0A484BRK6
Position
Unknown
AA seq 383 aa AA seqDB search
MASNNSNNIVDLRSDTVSQPTPEMRACMASAVVGDDVYGEDPTVAELEATTAALFGKEDG
LFVPSGTMGNLLAVMVHCSRRGSEAIVGDLSHIFLYEQGGSAHLAGVQLAQLRNLPDGTF
SLEELRHKIRQYEDCHEPITSLVVVENTHNMCGGKVLPLSYLDELVSLVRDSGLGVVRIG
LHMDGARVFNAAAALGVKVERIARGFDSVSVCLSKGLSAPVGSVLVGSKKFIAEACRLRK
ALGGGMRQAGILAAAGLVALNKVVPLLAADHERTKRIAKSIDQLHSPNVVVDLATVQSNI
LLIQIKQPKLTASQFAERLAVIEPEELLAGVTGSNGAGIVLKASARNWEFMRLVLYHQVD
DEQVELAIKKLTYVIKQYDARWP
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacaacagcaacaacatcgttgacctgcgctcggacaccgtcagccagccg
acaccggagatgcgtgcctgcatggccagcgctgtggtgggcgacgatgtctacggcgag
gatcccactgtcgccgagctggaggcaacaacagctgcattatttggcaaggaggatggc
ctatttgtgcccagcggcaccatgggaaatcttttggccgttatggttcattgcagtcga
cgtggctccgaggccattgtgggcgatttatcgcacatatttctctatgagcaaggtggc
tcggcgcacttggctggcgtgcaattagcccagttgaggaatcttccggatggcaccttc
agcctggaggagctgcggcacaagatacgccagtatgaggactgtcacgagccgatcacc
tccctggtcgtcgtggagaacacccacaacatgtgtggcggcaaggtgttgccgctgtcc
tatctggacgagctggtgtcactggtgcgcgattcgggcttaggcgtcgtacgcatcggc
ctgcacatggacggcgctcgagtgttcaatgcggccgctgctttgggtgtcaaagttgag
cgcatcgctcgcggcttcgactcggtctcggtgtgcctcagcaagggtttgtctgcgcca
gtgggctccgtattagtcggctccaagaaattcatagccgaagcttgccgactccgcaaa
gctctgggcggtggcatgcgacaggcgggcatcttggcggctgcaggattggtggccctg
aataaggtggtgccgctgctggcagcggaccatgagcgaacgaaacgcattgcgaaaagc
attgaccagctgcacagccccaatgtagttgtggacctggcgactgtgcagagtaacatt
ttgctgatacagattaagcagccaaagctgactgccagccagtttgcggagcgcctggct
gtcatcgagcccgaggagctgctggctggagtaacgggcagtaatggagcgggcattgtg
ctcaaggccagcgctcgcaattgggagtttatgcgtttagtgctgtatcatcaggtggac
gacgaacaggtggaactcgccattaagaagcttacctacgtcatcaagcagtacgatgcc
cgctggccctga

DBGET integrated database retrieval system