KEGG   Drosophila navojoa: 115564305Help
Entry
115564305         CDS       T05898                                 

Definition
(RefSeq) probable ATP-dependent RNA helicase pitchoune isoform X1
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
dnv  Drosophila navojoa
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dnv03041]
    115564305
   03009 Ribosome biogenesis [BR:dnv03009]
    115564305
Enzymes [BR:dnv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     115564305
Spliceosome [BR:dnv03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    115564305
Ribosome biogenesis [BR:dnv03009]
 Eukaryotic type
  90S particles
   Helicases
    115564305
  Pre-60S particles
    115564305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 AAA_22
Motif
Other DBs
NCBI-GeneID: 115564305
NCBI-ProteinID: XP_030244348
Position
Unknown
AA seq 711 aa AA seqDB search
MSIREKLLMKKIVKREKMKKELSQKKGKVKQAAPEAPVEKAGKNKPKKQKRPVEPEEEEL
KTSKAKQAASEPPVEKAGKNKPKKQKRPAEPEEDDLGDDFQQQPQSKGKKRQQLKKKPQI
EVANSDSESESEEEENPVSGSEAEDDDDDEEIDSEAANSADEGEEDEPAPAKKSKLQPKA
AKKTVTANGKATEEDAPFTVESSLAALDHRDSDDRTFASLKGAVSEATLRAIEEMGFTEM
TEIQAKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFMPRNGTGVIIISPTRE
LSMQTFGVLKELMAHHHHTYGLVMGGSNRQVESEKLSKGINILVATPGRLLDHLQNSPDF
LYKNLQCLIIDEVDRILEIGFEEELKQIINLLPKRRQTMLFSATQTERIDALSKLALKKE
PIYVGVHDNQETATVEGLEQGYIVCPSEKRLLVLFTFLKKNRKKKVMVFFSSCMSVKYHH
ELFNYIDLPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDVAARGLDIPQVDWIVQYDP
PDDPREYIHRVGRTARGSGTSGHALLMLRPEELGFLRYLKAAKVPLNEFEFSWQKIADIQ
LQLEKLIAKNYFLNQSAKEAFKSYVRAYDSHQLKQIFNVNTLDLQAVAKSFGFLVPPVVD
LKVGAAKRERPEKRVGGGGFGYYKQMNERGGGHKQRVFKQINRDQAKKFMR
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccgagagaaactactaatgaaaaaaatcgtcaagcgtgagaaaatgaagaaa
gagctctcacagaaaaagggcaaagtgaagcaggccgcgccggaagcgccagtcgaaaag
gctggcaaaaacaagccgaaaaaacagaaacgacctgtggagcctgaagaagaagagttg
aaaacgagcaaagcgaaacaggcagcgtcggagccaccagtcgaaaaggctggcaaaaac
aagccgaagaaacagaagcggcctgcggagcctgaagaagatgacttgggagacgatttc
caacagcagccgcagagcaaaggcaagaaacgccagcagctgaaaaagaagccacaaatt
gaggtcgcaaactccgattcagagtcggaatcagaagaagaagagaacccggtgagcgga
agtgaagcagaggatgatgacgacgacgaggagatagatagtgaagctgcaaactcagcc
gatgagggagaggaggacgaacctgcgccggccaagaaatccaagttacagcctaaagcc
gctaaaaagacagtcacagcaaatggcaaagctactgaggaagacgcaccattcactgtg
gaatcctctttggcggcattggatcatcgggattcagatgatcgcacctttgcctcactc
aaaggcgccgtctctgaggccacgttgcgtgccatcgaagagatgggcttcactgagatg
accgaaatccaggccaagtccttgacgccgctgctcaagggccgagatttggtgggcgcc
gcccagactggctcaggcaaaaccctggccttccttatacccgccgtggagttgataaat
aagttgaggtttatgccacgcaatggtacgggcgtcattataatctcgcccacacgcgag
ttgtccatgcagacgttcggtgtgctcaaggagctgatggcacatcatcatcatacctac
ggcttagttatgggaggctccaatcgccaggttgagagcgagaagctgagcaaaggcatc
aatattctggtggctacgccaggtcgtctgttggatcatttgcagaactctccggatttc
ctgtacaagaacttgcaatgtctgattatcgatgaagtggatcggatactggagattggt
tttgaagaggaactcaagcagatcatcaatctgctgccaaaacgccgccagactatgtta
ttctcggccacacagacggagcgtattgatgcgctgtccaagctggcgctcaagaaggag
cccatttatgtgggcgtgcatgataaccaggagacggccaccgttgagggacttgagcaa
ggctacattgtctgtccgtccgagaagcgtttgctggtgctcttcacgttcctcaaaaag
aatcgcaagaagaaggtcatggtcttcttctcctcatgcatgtcggtcaagtaccaccac
gagctcttcaactatatcgatctgccggtcacatctatacatggcaagcaaaagcaaacg
aaacggacgacgaccttctttcagttctgcaatgccgagtcgggcattctgctctgcacg
gatgtggcggcgcgtggcctggacataccgcaagtcgattggattgtgcaatacgatccg
ccagatgatccacgcgagtatattcatcgtgtgggccgtacggctcgcggctctggcact
tcgggacatgctttgctgatgttacggcccgaggaattgggcttcttgcgctatctgaaa
gcagccaaggtgccgctcaatgaattcgagttctcctggcaaaagattgccgacatacag
ctgcagctggagaaattgatagcgaagaactatttcctcaatcagtccgccaaggaggcg
ttcaagtcgtatgtgcgcgcctatgattcgcatcagctgaaacagatattcaacgtgaac
acgctggacttgcaggcggtggccaagagctttggctttctggtgccgccagtggttgac
ctcaaagtgggcgctgccaagcgcgagcggcccgagaagcgagtgggcggcggtggcttt
ggctactacaaacagatgaacgagcggggcggcggccacaagcagcgcgtcttcaagcag
atcaatcgggatcaggccaagaagtttatgcgttaa

DBGET integrated database retrieval system