KEGG   Drosophila navojoa: 115565767Help
Entry
115565767         CDS       T05898                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
dnv  Drosophila navojoa
Pathway
dnv03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    115565767
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dnv03012]
    115565767
Translation factors [BR:dnv03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    115565767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 115565767
NCBI-ProteinID: XP_030247030
Position
Unknown
AA seq 1143 aa AA seqDB search
MARYTQRPENALKRANEFIEVGKPLRALDTLQEVFRNKRWNYAYSETVIEPLMFKYLYLC
VELKKSHIAKEGLFQYRNMFQLVNVNSLENVIRGYLKMAEEHTEAAQAQSSAAVAVLELD
DLDNIATPESILMSAVCGEDAQDRSDRTILLPWVKFLWESYCQCLELLRVNTHCEALYHD
IARMAFQFCLKYNRKSEFRRLCDKLRKHLEDICKSSNQTTGVSINKVETQQLCLDTRLYL
LDSAIQMELWQEAYKAIEDIHGLMAMSKKTPVPKTMANYYQKLAMVFSKAGNQLFHAAAL
LKLFQLTRELKKNLTKDDLQRMAAHVLLATLSIPLPSAHPEFDRFIEADKSPLEKAQKLA
VLLGLPQPPTRVSLIREVVRLNVPNLVSEDFRNLYNWLEVDFNPLNLCKRIQSIVDTIEA
SETENTLLTPYIQSLKDVTIMRLIRQISQVYESIEFKRLLELAPFCNIFELEKLLVESVR
HNDMQIRIDHQRNSIYFGTDLTESQREYRPDGPTLQSMPSEQIRSQLVNMSTVLTRAVSI
VYPNRERDQRAKLRSQMVQHYHEIKDREHQRILQRQKIIEDRKEFIEKQNNAREEEEARR
HEEESRKAKLAEQKRLEQEQEERERKRHENEIQAIKEKSLKEKVQQISQTAHGKKMLSKL
DEEGIKKLDAEQIAMRESEELQRERKELQSKLKSQEKKVDYFERAKRLEEIPLFEKYLAE
KNVKDKEFWEATEATRIENAIAERKDAVSQQERLKRMYPDRDEFLEALKKERASLFVEKL
KKFEIALAEERKKRLAERVVRRREERRQAYLRAKEEERFRKEEEIRLAREAEERAAAEAR
RLEREAEDEKRRQQYEKQRAKEEEAERKIQEDRERLAREVAVERERSEKERDVWRPRGDR
SERPSAAAGGASEWRRNAPTSDRNDRNDRNDRNDRSDRNDRNDRSDRIERSDRNDRPERK
DTDGGADSSWRVRREPVESQRGPGAANTGMDRSERGGGAGAGGPSGRDDKWRRGGDRSDR
LGGDRDRDRDRDRDSFRRNDGPRRDDDRGGFRRDDQPQRDTGSNWRDSPRQNDRDNRDNR
RPAGDRRDVRGAGPKEGGGGGGGGNWRTAPAPRDEKPPVKRDQPQDKENKAGDDGEWTSV
KRR
NT seq 3432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgttacactcaacgtccggaaaatgctcttaaacgagccaatgaatttattgag
gttggaaagcctttgcgtgccctggatacgttgcaggaggttttccgcaacaagaggtgg
aattatgcctactccgagacggtcattgagcctctcatgttcaagtacttgtacttgtgc
gtggagctcaagaagtcgcatattgccaaggagggtctcttccaatatcgtaacatgttc
caattggtgaatgtgaactcactggagaatgttatacgcggctacttgaaaatggccgag
gagcataccgaggcggctcaggcgcaatcatcggccgccgtggctgtgctggagctggat
gatcttgataatattgcgacaccagagagcattttgatgagtgccgtttgcggagaggat
gcccaggatcgttcggatcgtactattttgttgccatgggttaaattcctttgggaatcc
tattgccagtgtcttgagctgttgcgcgtcaacacccattgcgaggcgctctatcatgat
attgcgcgcatggcttttcagttttgcttgaagtacaaccgaaagagtgaattccgtcgc
ttgtgtgacaagctgcgtaagcatcttgaagacatctgcaagagcagcaatcaaacaaca
ggcgtgtctatcaacaaggtcgagacacagcagctgtgcctggataccaggctctacttg
ttagactcggccatacagatggagttgtggcaagaggcctacaaggcaatcgaggacatt
cacggcctgatggccatgtccaagaagacgccggtgccaaaaaccatggccaattactat
cagaaattggcaatggtcttcagcaaggctggcaatcagctcttccatgcagccgctttg
cttaagctgttccagttgactcgtgagctcaaaaaaaatcttactaaggatgatctgcag
cgtatggctgctcatgtacttctggctacactgtcgatacctctgccttctgctcatccg
gaattcgatcggttcatcgaggcggacaagagtcctctagaaaaagctcagaagctggcc
gtgctgctgggtctgccccagccgccaacgcgtgtctctctaatccgagaagttgtgcgc
ttgaatgtgccgaatctggtatccgaagacttccgtaacctatacaactggctcgaagtg
gactttaacccactcaatctatgcaagcgtattcagtctattgtggataccattgaagcc
agtgaaacggagaatactctgctcacaccttatatccaatcgttaaaggatgtgactata
atgcgtctaatacgtcaaatctctcaagtctatgagagcatcgagtttaagcgtttgctg
gaactggcgccgttctgcaatatttttgagctggagaaactgttggtggagtcagtgcgt
cacaatgacatgcaaatacgcattgatcatcagcgcaacagcatttacttcggcaccgat
ctaactgagagtcagcgcgagtatcgtcctgacggacccacactgcagtcgatgccctcg
gagcagattcgttcccagctagtcaacatgtccaccgtgttaactcgagccgtatctatt
gtatatccgaatcgggagcgtgatcagagggctaagctgcgtagccaaatggtgcagcac
taccatgagatcaaggatcgtgaacatcagcgcattctgcagcgccagaagatcattgaa
gatcgtaaggagttcattgagaagcagaataatgcccgtgaagaggaagaggcccggcgc
cacgaggaggagtcacgtaaagccaagttggccgagcagaagcgattggagcaggaacag
gaggagcgggagcgcaagcgtcatgagaacgaaatccaggcgatcaaggagaagagcctt
aaggagaaggtgcagcaaatatcgcagactgcgcacggcaaaaaaatgctttccaaattg
gatgaggaaggcatcaagaagctcgatgctgagcaaattgctatgcgtgaaagcgaagag
ctgcagcgagagcgcaaggagctacagtccaagctcaagtcgcaagaaaagaaggttgat
tactttgagcgtgccaagcgtcttgaggagattccgctctttgagaaatatttggctgag
aagaatgtcaaggacaaggagttttgggaggccaccgaagccactcgcattgagaatgct
attgccgaacgcaaggatgccgttagccagcaggagcgccttaagcgtatgtatcccgat
cgcgatgagtttctcgaagcactcaagaaagagcgtgcctcgctcttcgttgagaagctc
aagaaattcgaaattgctcttgcggaggagcgtaagaagcgtctcgctgagcgtgtggtg
cgtcgtcgtgaggaacgccgccaagcctacctgcgtgccaaggaagaggaacgtttccgc
aaggaggaagagatacgtcttgctcgcgaggccgaagagcgtgccgctgccgaggctcgt
cgtctggaacgtgaggcagaggatgagaagcgtcgtcagcaatatgaaaagcaacgtgcc
aaggaggaggaggccgaacgcaagatccaggaagatcgcgaacgtcttgcccgcgaggtc
gctgtcgagcgtgagcgcagcgaaaaggaacgcgatgtctggcgtccacgcggtgatcgc
agcgaacgaccaagtgctgcagccggcggtgccagcgagtggcgtcgtaatgctcctaca
agtgatcgcaatgaccgtaacgatcgcaatgaccgtaacgatcgtagcgatcgcaatgac
cgtaatgatcgtagcgaccgcattgagcgtagcgatcgcaatgatcgcccagagcgcaag
gatactgatggcggtgctgattcgtcatggcgtgtgcgccgtgaacctgtcgaatcacag
cgtggtccaggtgctgctaacactggtatggatcgttcagagcgtggtggcggtgctggc
gctggtggtccgtctggtcgcgatgacaagtggcgtcgtggtggtgatcgctccgatcgc
cttggtggtgatcgtgatcgcgatcgtgatcgtgatcgtgactcattccgccgtaatgat
ggaccacgccgtgatgatgatcgcggtggctttcgtcgtgacgatcagccccagcgtgac
acaggcagcaactggcgcgattcgccccgtcaaaacgatcgcgataatcgagataatcgc
cgtccggctggcgacagacgcgatgttcgtggcgctggacccaaggaaggaggcggcggt
ggcggtggtggtaactggcgtacggctccagctccacgcgatgaaaaacctccggtcaag
cgcgatcagccacaggacaaggaaaacaaagctggagatgatggcgaatggacaagcgtc
aagcgtcgttaa

DBGET integrated database retrieval system