KEGG   Diuraphis noxia (Russian wheat aphid): 107161297Help
Entry
107161297         CDS       T04900                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00970  Aminoacyl-tRNA biosynthesis
dnx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107161297
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dnx03029]
    107161297
Enzymes [BR:dnx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     107161297
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     107161297
Mitochondrial biogenesis [BR:dnx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    107161297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 107161297
NCBI-ProteinID: XP_015363143
Position
Unknown
AA seq 517 aa AA seqDB search
MHARKLLMKNTFQQVLNPLKLSRNKSMKTFDKHKWKSVVGLEIHAQISSESKLFSAAGTK
FDAVVNSQVALFDAAIPGTLPSINEKCVEAAILTALVLGCNLNTVSLFDRKHYFYADMPA
GYQITQQFHPLAENGQLTFHVIDQNINIVPYSKTSLIKQIQLEQDSGRTIHDDSSKTSLI
DLNRAGTGLMELVFEPDLCNGLEASALVKELLLIFERIKTCSGRMEEGALRVDANVSITD
CDQLGTRTEIKNLGSIRAVQLAVDYEIFRQLNLIKEKKEVVNETRGWDSVTNKTVSMRDK
EVLQDYRFMPEPNLLPLNLNMFDIXKLQTKIPELPTVTRNNIMSKYGLNIRKTTTLMNEP
VLLSMFFEIMNYDTFRNPSRVWNVLTIEFMTELNKRSIEPKKSQIPSHIIGEIVDLLDNK
LVNLVHARKIIAKIFDEKNKSPSQIVEENNWQQISDLEEINKLCKEVMLEYPKAVKDYRR
GKLQAIKFLINHVAKKTNDRANLALVSKNLEEFLKND
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccagaaaactattgatgaaaaatacctttcaacaagtattaaatccgcttaaa
ctttcaaggaataagagcatgaaaacttttgataaacataaatggaaaagtgttgttgga
ttggaaatacatgctcaaatttcaagtgaatcaaagttgttcagtgcagctggtactaaa
tttgatgcagtggtaaattcacaagtggcattgtttgatgctgcaattcctggaacactt
cctagtattaatgaaaaatgtgttgaggcagccatattaactgcgttagtattaggatgt
aatcttaatacagtatcattatttgatcgtaaacactacttttatgcagatatgccggca
ggttaccaaataactcaacagtttcatccattagcagaaaatggtcaacttacttttcat
gttatagatcaaaatattaatatagttccctacagtaaaacttctttaatcaaacaaata
cagctagaacaagacagcggacgtacaattcatgatgattcttctaaaacttcacttata
gatttaaatcgtgccgggacagggctaatggaacttgtgtttgaacctgatttgtgcaat
ggtcttgaagcttctgctttagtcaaagagttattactaatatttgaacgtatcaaaaca
tgttctggtcgtatggaggagggtgctttaagagttgatgctaatgtttcaatcactgac
tgtgatcaactaggcacacggactgaaataaaaaatttgggaagcatacgagctgtacag
ttagcagtcgattatgaaatttttcgtcaattaaacctaataaaagaaaaaaaagaagta
gtgaacgaaacaagaggatgggattctgttactaacaaaacagtatcaatgagagacaaa
gaagttttacaagattatcgatttatgcccgaacctaatttattaccacttaatttaaat
atgtttgatattaawaaattacaaacaaagattcctgaattaccaactgtaactcgtaat
aacattatgagcaaatatggtttgaacataaggaaaactactactttaatgaatgaacct
gttttattatcaatgttttttgaaataatgaattatgatacatttagaaacccatcaaga
gtttggaatgtattgaccattgaatttatgacagaattgaataagagatcaatcgaacct
aaaaaaagtcaaattccttcacatatcattggcgaaatagtagatttactggataataaa
ttagtaaacttagtccatgcaagaaaaattattgctaaaatatttgatgaaaaaaataaa
tctccatctcaaattgtagaagaaaataattggcaacaaatttctgatttagaagaaata
aataaattatgtaaagaagttatgcttgagtatccaaaggctgtcaaagactaccgtaga
ggaaaattacaagccataaaatttttaataaatcatgttgcaaagaaaacaaatgatcgt
gctaatttagctcttgtttcaaaaaacttagaagaattcttaaaaaatgattag

DBGET integrated database retrieval system