KEGG   Diuraphis noxia (Russian wheat aphid): 107163012Help
Entry
107163012         CDS       T04900                                 

Definition
(RefSeq) succinyl-CoA ligase subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00020  Citrate cycle (TCA cycle)
dnx00640  Propanoate metabolism
dnx01100  Metabolic pathways
dnx01200  Carbon metabolism
Module
dnx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dnx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107163012
   00640 Propanoate metabolism
    107163012
Enzymes [BR:dnx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107163012
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107163012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 107163012
NCBI-ProteinID: XP_015365710
Position
Unknown
AA seq 330 aa AA seqDB search
MAASTRVFSRIAVCNLMGIRSSSNTVDPRIYAETRKNLLLTKDTKVICQGMTGKQGTFHS
TQAIEYGTCMVGGVSPGKGGKTHLGLPIFNSVKEARDETGADATVIYVPPPGAAKAIXEA
IDAEVPLIVCITEGIPQQDMVRVKHKLIRQNKSRLLGPNCPGIIAPEQCKIGIMPGHIHL
KGSVGVVSRSGTLTYEAVHQTSQVGLGQTLCVGIGGDPFNGTDFIDCLEVFLQDPNTHGI
ILIGEIGGLQEEMAAEYLIEHNTGPNAKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGAQ
DKINALEKAGVVVTRSPAAMGIELSKLMKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttccaccagggttttctccagaatcgcagtatgcaatttaatgggtatacga
tcatcatcaaatacagttgatccacgcatctatgcagaaacaagaaaaaatttacttctc
actaaagatactaaagtaatttgtcaaggaatgactggtaaacaaggaacattccattct
actcaggctattgagtatggaacttgtatggtaggcggtgtctcccctggcaaaggtgga
aaaactcatttaggtttaccaattttcaattcagtcaaagaagcaagagatgaaaccgga
gcggatgctacagttatttatgtaccaccaccaggcgctgcaaaagcaatctyagaagct
attgatgccgaggttcctttaattgtttgtattacagaagggattccccagcaagatatg
gtacgagtgaaacataaattaatcagacagaacaaatctagattacttggacctaattgt
cctggaatcattgctccggaacaatgtaaaattggtattatgcctggtcatatccatttg
aaaggatctgttggagttgtatctcggtcaggtacacttacttatgaagcagttcatcaa
acatctcaagttggtcttggacaaacgctttgtgttggaattggtggtgatccattcaat
ggtactgattttatagattgcttagaagtatttttacaagacccaaatacacacggtatt
attttgattggtgagattggtggtctacaagaagaaatggctgctgagtatttaattgaa
cataatactggtccaaatgctaaaccagttgtatcattcattgctggattaacagcaccg
cctggtcgcagaatgggccatgctggagcaatcatatctggtggaaaaggtggagctcaa
gacaaaataaatgcattagaaaaggctggtgtggtcgttactaggagcccagctgctatg
ggcattgaactatctaaattgatgaagaaatga

DBGET integrated database retrieval system