KEGG   Diuraphis noxia (Russian wheat aphid): 107163583Help
Entry
107163583         CDS       T04900                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx03040  Spliceosome
dnx04141  Protein processing in endoplasmic reticulum
dnx04144  Endocytosis
dnx04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107163583
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107163583
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107163583
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107163583
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dnx01009]
    107163583
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dnx03041]
    107163583
   03009 Ribosome biogenesis [BR:dnx03009]
    107163583
   03110 Chaperones and folding catalysts [BR:dnx03110]
    107163583
   04131 Membrane trafficking [BR:dnx04131]
    107163583
   03051 Proteasome [BR:dnx03051]
    107163583
   03029 Mitochondrial biogenesis [BR:dnx03029]
    107163583
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnx04147]
    107163583
Protein phosphatases and associated proteins [BR:dnx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107163583
Spliceosome [BR:dnx03041]
 Complex B
  Other components
   Prp19 complex
    107163583
 Complex C
   Prp19-CDC5 complex
    107163583
Ribosome biogenesis [BR:dnx03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107163583
Chaperones and folding catalysts [BR:dnx03110]
 Heat shock proteins
  HSP70 / DNAK
   107163583
Membrane trafficking [BR:dnx04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107163583
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107163583
Proteasome [BR:dnx03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107163583
Mitochondrial biogenesis [BR:dnx03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107163583
Exosome [BR:dnx04147]
 Exosomal proteins
  Proteins found in most exosomes
   107163583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Hydantoinase_A SHS2_FTSA
Motif
Other DBs
NCBI-GeneID: 107163583
NCBI-ProteinID: XP_015366535
Position
Unknown
AA seq 654 aa AA seqDB search
MAAKTPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV
AMNPNNTIFDAKRLIGRRFEDTTVQADMKHWPFEVVSDSGKPKIRISYKGENKIFSPEEV
SSMVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVMRIINEPTAA
AIAYGLDKKTSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVN
HFVQEFKRKYKKDVTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSITR
ARFEELNADLFRSTMEPVEKSLRDAKMDKSAINDIVLVGGSTRIPKVQKLLQDFFNGKEL
NKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTT
IPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFD
IDANGILNVSAIEKSTNKENKITITNDKGRLSKEDIERMVNDAEKYKNEDEQQKNIIAAK
NGLESYCFNMKSTMEDEKIKEKIPESDKNTILEKVNETIKWLDANQLAEKEEYEHKQKEL
EGICNPIITKLYAGAGGGMPGGPGGMPGFPGAAGAGGPAPGAGSGAGPTIEEVD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaaactcctgctgttggtattgatttgggtacaacttactcttgtgtcggt
gttttccaacacggcaaagtagagataattgccaatgaccaaggcaaccgtaccacaccc
agttatgttggtttcaccgatactgaacgtcttattggtgatgctgctaaaaaccaggtc
gctatgaaccccaacaacacaatttttgatgccaagcgtttaattggaagacgttttgaa
gatactactgtacaagctgatatgaaacattggccttttgaagtagtcagtgatagtggt
aaacctaaaatcagaatttcctacaaaggagaaaacaaaatcttctctccagaagaggta
tcatctatggttttgaccaagatgaaggaaactgctgaagcctaccttggaaaaacggta
tcaaatgctgttatcactgtgcctgcatatttcaatgactcccagcgtcaagctaccaaa
gattctggaaccattgctggtttaaacgtaatgcgtatcatcaatgagcctaccgctgct
gccattgcttatggtttggataagaaaacatctggagaacgcaacgttctgatctttgat
ttgggtggtggtacttttgatgtatccattttgaccattgaggatggaatatttgaagtc
aaatcgactgctggagacactcacttgggaggagaagattttgacaacagaatggtcaat
cactttgtacaagagtttaaacgcaaatacaagaaggatgtaaccactaacaagagagcc
ctgaggcgtttaaggactgcttgtgaacgtgcaaagcgtactctttcctcatctacccaa
gcaagcattgaaattgattccttgtttgaaggtgttgacttctatacatctatcactcgt
gctcgttttgaggagttgaatgctgatcttttccgtagcaccatggagccagtagaaaaa
tctctgcgtgatgccaagatggacaaatctgccatcaatgatattgtgttggttggaggt
tctacccgtatccccaaagttcaaaagttgttgcaagacttcttcaatggtaaagagttg
aacaaatcaatcaaccccgatgaagctgttgcttatggtgcagcagtacaagccgctatc
ttacacggagacaaatctgaagaagtccaagacttattgttgctcgatgtcacccctctg
tctttaggtattgagactgctggtggtgtgatgaccgctctcatcaagcgtaacacaacc
atcccgactaaacaaacccaaactttcactacctactctgacaaccaacctggagtcttg
atccaagtgtatgaaggagaacgtgctatgacaaaggataacaatttgttgggaaaattc
gaactgacttctattcctcctgcaccacgtggagtaccccagatcgaagtcaccttcgac
attgacgccaatggtattttgaacgttagtgctattgaaaaatctaccaacaaagaaaat
aaaatcaccatcaccaatgataagggacgtttaagcaaggaagatatcgaacgtatggtc
aatgatgctgaaaaatacaagaatgaagatgaacaacaaaagaatatcattgccgctaag
aatggtttggaatcctactgtttcaacatgaagagcacaatggaagatgaaaaaatcaaa
gaaaagatcccagaatcagacaagaacacaattttagaaaaagttaacgaaacaatcaaa
tggttggatgctaaccaactggctgaaaaggaagaatatgaacacaaacaaaaagaattg
gaaggtatttgcaacccaattatcaccaaattgtatgctggtgctggtggtggtatgcca
ggtggtcccggtggtatgccaggattcccaggagctgctggtgctggtggtcccgcccca
ggtgctggttcaggagctggtccaactattgaagaagttgattaa

DBGET integrated database retrieval system