KEGG   Diuraphis noxia (Russian wheat aphid): 107163822Help
Entry
107163822         CDS       T04900                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dnx04131]
    107163822
Membrane trafficking [BR:dnx04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107163822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 107163822
NCBI-ProteinID: XP_015366895
Position
Unknown
AA seq 2304 aa AA seqDB search
MVSQMQRAFAQKLTSSNINSSPKSSEDAAVSLNANTILSNNDQNISTRLDVIIPTIVEPV
DYENYNHQHHTCGSNSIENDDPLMEFPDGSDDVDVYVLARKVRTLIPAGPEEDITKLAPH
VRDFVRAYSRDWLVVDYVNRQTNTVEDDRSSLLAYEDSWIPSSRTSTYSRTSTNSASQRT
QQRLIYKNDHHNYPQQPKDLIKLSSKNSSSTSNSSSTENTSVSNTITGGSSSATDLINTA
NDPLIGTVLQRLPIDTLDRLNAVARQENRQNRLFGSYLPVKTRQKCNNYIEYPIKPPVPR
EIVSNRRILVKCLQLECSLEIETEPVYAHMSLYDVRRRKKMSENFYFDFNSCTTAGNEID
TTTRSRTCVLDIDGTGSNSGDDLFLVIRLEKPLRGDSDSVIPASDTSTFSNNDKMDMKSS
SKSIQHHHVKYRMPYAWTAVHLADVICCSGGSDSLDRNSTGSGSNSLDGRFGLSEFDRFR
KKWTAAGGSSMDSNTAVRRGSLDRRTSYSTAANSSGTLSASNTADNRYSWSSDEFSTDVF
RPVTLTVNGFFKQETDKLKDDDLYKLLQELKKPSSCPSKKLKNVNGSLKLDISPCPTDEV
KQCLTADLIPLSSYDIASEDKIRPIREILEFPLASCRVSNPHYVYRNLLYVYPKELNFAG
RTGSARNIAVKVQLMCGERQPQDAACAIFGKSSSPRYVCEAYTAVSYHQRCPSFYDEIKI
KLPADLDDRHHLLFTFYHVSCRRRGTLVGGQDNHQHRPQVAPETPIGYTWLPLLKDRCLS
SGEICLPVALEPPPPANYSYITPDVALPGIEWVENHKGLFTVHLEPVSSIHPRDIHLNNF
FNYCSVLERNPLPRRVAESNIEAELKHRISNLVRCQIDPLIEFVPVVLDKLLSLLVESPV
TQHQQPMNLGQIIFRTLADLVSMTMSHSQGQQILSSYVRYQCCCCNVAAAAVANAKNNSS
ETENDVYSGGQEYSERLDKYFRLRSNSDPDTTKKPCSSPLLDGNTFAVFKNSGLDRACSM
KTGRCQGSIPPSQFDEKQHQLFCSDQKRLTSIKSVHEELALQWVVATSTVRRDAAANNSR
FFFDVIIKSMAVSLAMVPGGLDSDRKNRFSDQFFDDISTLCTSFALDIVSNYEKDSKQVN
IINCNLGWFLHDLLSLADRGFVFGLINTYVKTLFSKQQSLLNQLPHHENYSTLSSLKLDF
LKIVSSHEHYVPLNLISNNFHNLSPTYSVASTISNQSLSMVSNTITTATEATVKEYSDLS
LGFRRHHYLVGLVLSEFVTVLQCSKSDLKVKEKVVDLLLGLMSSHDTRYQQDKWSSRRKA
STRVALMYLPLLTAVTTDSSFLNLLQLDFENSNDVVKNKLLNSENEIDFDYVDGYKTSEK
KTDENVNAISASSLMGVKNTTASWYRQTNKNNCLKPKLNTIISTKVLACILWILKNLDND
IMQVWLAESSHLRAQNTLSILTLCINRFYNNSNNYKKGNHKCVNCNTQSSFTSTTNSFQP
ASSETYNINDSSNNISTTASTTSLSSSSQLSAADDVKSRLEDVILGQGSARSELMRRKAG
LDAGNTTGTTSKVRWRKDHVLTYNRSSSLQSCSCYVDCQQQLDKIFGSNHDQPDVELDLV
NEIGFIILDTIEQIIQVASLPAGLKNSNPVHWSIHRIFKLLLRAMSTIIATTNNQQYSNG
SSTSTTAALQCMFGTQRSMVAKFPELLFGDGLDERDLDVNDDDKEIENYHFSTSSPSSNR
CANLILMLLRHCAIKSSSIGVRAQAAASLYSLMRQNFDIENNFARVKMQITVALSTLIGG
AGVSSTAASENRKEGLCFNEEYLRRVLKTILLYAERDSAELQNTTFPEQVKDLVLNLHTI
LSDTVQMKAYSQDPDMLMDLMYRVAKGYQQTSSPDLRLAWLENMARKHNQRNNFTEAAMC
LIHGAALVIEYLTTTENLDLIGCRGATCLECVSPNVLEECAVSDDVMVVSQAADQVCLGD
EFTEIGLVSLLDRAAELFQKAGMFEVMSQVYNKVAIPLIEKTNDYKKLSDTYLKLHDAYG
KLEKLQGRRVFGTYFRVGFYGAKFFGSDGLDGEEFVYKEPTLTKLSEIFGRLQNFYSERF
GEDCVTIIKDSNTVDVSILDPRKAYIQITYVEPYFDAYERRMRATHFQRNFNLKRFVFFT
PFTPDGRAHGQLNQQYKRKTILTVEHHFPYLKTRIRVQSRQTIVMGPIEVALEDLKKKTD
ELARSVRQHPADPKMLQMVLQGCIGTTVNRGPMEMATVFLAPPRYDKNTNDRSPEILDEC
SVQPPPPPRLQNKLRLCFKDFSKK
NT seq 6915 nt NT seq  +upstreamnt  +downstreamnt
atggtatctcagatgcaacgagcatttgctcaaaaacttaccagcagcaatatcaattca
tctccaaaatcgtcagaagatgcagcagtgtctttaaacgccaatactattctatcaaac
aatgatcaaaatatttctaccagattagatgttattatacctacaattgtggagcctgta
gattatgaaaactataatcaccaacatcatacttgtggaagtaacagtattgagaatgac
gatcctttaatggaatttcctgatggttcagacgatgtagacgtttatgttttggcacgt
aaagtgcgtacactgatacctgcaggtcctgaagaagatatcaccaaactagcaccacat
gtacgtgattttgttagagcttacagccgagattggctcgttgttgattatgttaataga
caaactaatactgtcgaggatgatagatcaagtttattagcttatgaagattcttggata
ccttcatctcgaaccagtacttatagtaggacttcaacaaattctgcatctcaacgtact
caacaacgtctaatttataaaaatgatcaccataattatccacaacaacctaaagattta
attaagctcagtagtaaaaattcaagttctacaagcaatagctcaagtactgaaaataca
tcggtatctaatactattactggtggttcatcttcagctacagacctgatcaacacagct
aatgatccactaattggaactgtattgcagagattaccaatcgatacactagataggtta
aatgcagtggctcgtcaagaaaatagacaaaaccgtttatttggatcatatttacctgta
aaaacacggcaaaaatgcaataattatattgaatacccaatcaaacctccagtaccacgt
gaaattgtttctaaccgcagaattttagtcaaatgtctacaacttgagtgttctttggaa
atagaaactgaacctgtatatgctcatatgtcattgtatgatgttcgacgtaggaaaaaa
atgtcagaaaatttttattttgattttaactcttgtactactgctggtaatgaaattgat
acaactacacgtagtcgtacttgtgtacttgatatagatggcacaggatcgaattctgga
gatgatttatttttagtcattaggctagagaaaccattacgtggcgattctgattcagtt
attcctgcttcagatacatcaacattttctaacaatgataagatggatatgaaatcaagt
agtaaatcaattcaacaccatcatgttaagtatcgaatgccatatgcttggactgctgtg
catttagcagatgtgatttgctgttctggtggttcagatagtcttgatcgtaatagtaca
ggaagtggatcaaatagtttagatggtaggtttggtctcagtgaatttgataggtttcgt
aaaaaatggactgcagctggtggaagtagtatggattctaatacggctgttcgtcgaggg
tcactagatcgcagaactagttattcaacagcagctaatagtagtggaacmttaagtgca
tctaatactgctgataatcgttacagttggtcttctgatgaattttctactgatgtattt
cgtccagttactctcactgttaatggattttttaaacaagaaactgataaacttaaagat
gatgatttgtataaactgctacaagaattaaaaaaaccttctagttgcccttcaaaaaaa
ttaaaaaatgttaatggttctttgaaactagacatatctccttgtccaactgatgaagtt
aaacagtgtttgactgcagacttaataccattatcatcatatgatatagcctctgaggat
aaaattcgaccaattagagaaatattggagtttccattagcgagctgccgtgtttcaaat
cctcactatgtttatcgtaatttgctctatgtttaccctaaagaattaaactttgctgga
agaacaggttctgctagaaatattgctgttaaagttcaattaatgtgtggtgaaagacaa
ccacaagatgcagcatgtgctatatttggaaagtcttctagtcctcgttatgtatgtgaa
gcatatacagcagttagctaccatcaacgctgtccatcattttatgatgaaattaagata
aaattaccagctgatttagatgatcgccatcatttattatttacattttatcatgtaagt
tgccgtcgtcgtggaactcttgttggtggtcaagataatcatcaacatagaccacaagtt
gcaccagaaacaccaattggatatacatggttacctctactaaaagacagatgcttaagt
tctggagaaatatgtttacctgttgcattagaaccaccaccacctgcaaattattcttat
attacacctgatgtggctttacctggaattgaatgggtagaaaatcataagggcttattt
acggtacatttggagccagtgtcatctattcatcctagggatattcatttgaataatttt
tttaattactgttctgtattggaacgtaatccattaccaagacgagtggctgaatcaaat
attgaagctgaactcaaacatagaatttcaaatttggttcgttgtcaaattgatccactt
atagaatttgtaccagtagtactcgataaattgctctccctattggtagagtcgcctgtt
actcagcatcaacaacccatgaatttgggacaaataatatttcgtactttagccgatttg
gtgtcaatgacaatgagccattcacaaggtcagcaaatattatcttcttatgtgcgttat
caatgttgttgttgtaatgtagctgctgcggcagtagcaaatgctaaaaataattcaagt
gaaactgaaaatgatgtatattctggtggacaagagtattcagaaagactagataaatat
tttcgtttaagaagtaacagtgatccagacacaacaaaaaaaccttgttcttcgccactt
ttggatggtaatacctttgctgtatttaaaaatagtgggttggatagggcttgcagtatg
aaaactggtcgttgtcaagggagtattccaccatcacaattcgatgagaaacaacatcag
cttttctgttctgatcaaaagagattgacttccatcaaaagtgtacacgaagaattagca
ttacaatgggtggtagctactagtacagtacgtcgtgacgctgcagctaataattcaaga
tttttttttgatgttataattaaaagcatggctgtttcattagcaatggtacccggagga
ttagatagtgatcgtaaaaatcgttttagtgatcaattttttgacgatatttccacatta
tgtacaagttttgctctagatattgtatccaactacgagaaagactctaagcaggtgaac
ataataaattgcaatttagggtggtttttgcatgatttgctatctttagctgacagagga
tttgtatttggtctgataaatacttatgtgaaaacattattttcaaaacagcaaagtctt
cttaatcaattgcctcatcatgaaaactattccactttgtctagtctaaaattggacttt
ttgaaaattgttagtagccatgaacattatgtgccattaaatttgattagtaataatttt
cataatctgtcaccaacctactctgtggcatctacaatttcaaatcagtctttgtcaatg
gtcagtaatacaataacaactgccacagaagctacagtaaaagaatattccgatttatca
ttaggatttcgtcgtcatcattatttggttgggttagtgttatcagagtttgtcacagtg
ttacaatgttctaaaagtgatttaaaagtcaaagaaaaagtggttgatttattattgggt
ctcatgtcatctcatgatactcgttatcaacaagataagtggtcatctagacgcaaagcg
tcaacaagagttgctctaatgtacttgccattattaaccgctgtaaccacggattcatca
tttctcaacttgttacaattagattttgaaaatagtaatgatgtggttaaaaataaactt
cttaatagtgaaaatgaaattgattttgattatgtcgatggttataaaacttctgaaaaa
aagaccgatgaaaatgtgaatgctatttcagcatcttcattaatgggtgtaaaaaatacc
acagcgtcttggtacagacaaacaaataaaaataattgccttaaacctaagttgaacaca
attatatccaccaaagttttagcttgcatattatggatattgaaaaatctagacaatgac
ataatgcaagtgtggttagctgagtcatctcatttaagagctcaaaatactttatcaata
ttgacattgtgtattaaccgtttctacaataattctaacaactataaaaagggtaaccat
aaatgtgtgaattgtaatactcaatcttcatttacatcaactactaactcttttcaacca
gcttctagtgagacgtataatattaatgatagtagtaataacatatcaacaacagcttct
actacatcgttatcgtcttcatcacaattgtcagctgctgatgatgtaaaatcgaggctt
gaagatgtaatattaggtcaaggatcagctagatcagagttgatgcgccgaaaagccgga
cttgatgctggtaatactactggcactactagtaaagtaagatggagaaaagaccatgta
ttgacatataatagatcttcatcattgcaatcttgttcctgttatgtcgattgtcaacaa
caacttgataagatttttggcagtaatcatgatcaacctgatgttgaattagatttagtt
aatgaaattggtttcataatactagacaccattgaacaaatcattcaggtggcttctttg
cctgctggcttgaaaaattcaaatcctgtccattggtcgattcatcgtattttcaaactg
ttgcttagagccatgtctactatcattgctactactaataatcaacaatactctaatggt
agttcaacatcaacgacagctgcactacaatgcatgttcggtacacagagatcaatggtt
gcaaagtttccagaacttttatttggagatggcctagatgaaagagatttagatgttaat
gatgacgataaagaaatcgaaaactatcacttttccaccagcagtccatcatctaatcgt
tgtgctaatcttatattgatgttattgcgccattgtgctataaaatcaagttcaatagga
gtccgagcacaagcagctgcctctttatactcgttgatgcgtcaaaactttgacattgaa
aataattttgctcgtgtgaagatgcaaataactgtggcattaagcacattaataggaggt
gctggagtgtcatcaacagctgcatctgaaaatagaaaagaagggttgtgtttcaatgaa
gaatatttgagacgagtgttaaagacaatacttttgtatgctgaacgagattccgctgaa
ttgcaaaacaccacattccccgaacaggtaaaagatcttgtattaaacttacacacaata
ctttcggatacagtccaaatgaaagcatatagccaagatccagacatgttaatggatttg
atgtaccgcgtagctaaaggatatcagcagacttcatcaccagatctccggcttgcatgg
ctagaaaacatggctcgaaaacataatcaaagaaacaattttactgaagcagctatgtgt
ttaattcatggcgctgcattagtcattgagtatctgactacgacagagaaccttgattta
attggatgtagaggtgccacatgtcttgagtgtgtatcgcctaatgttttrgaagaatgt
gcggtatcggatgacgtgatggttgtcagtcaagcggccgatcaagtatgcttgggcgat
gaatttaccgaaattggacttgtgtcgttgttggacagagcagcagaattattccaaaag
gccggtatgtttgaagtaatgagtcaagtgtacaacaaagtagcaatacctctaatagaa
aagactaatgattacaaaaaactatcggatacttatttgaaattacacgatgcgtatggt
aaattagaaaaactacagggtcgtcgggtatttggaacgtatttccgtgttgggttttat
ggtgccaagttttttgggtctgacgggttagatggtgaggaatttgtctataaggaacct
acactcacgaaactttcagagatatttggacgtttgcagaatttttattctgaacgattt
ggtgaagattgtgtaactattatcaaagactctaacacggtagatgtgagtatattagat
ccaagaaaagcatacatacaaatcacatacgtggaaccgtattttgatgcgtatgaacgg
cgtatgcgtgccacacatttccaamgaaattttaacttgaaacgcttcgtatttttcaca
ccatttactcctgacggccgagcacatggacaattaaatcaacagtacaaacgtaagact
attttgacygtagaacatcattttccctacttgaaaacccgaattcgcgtacaaagtcgc
caaacaattgttatgggacccatagaggtggcgttagaagacctaaaaaagaaaactgac
gaactagcacgcagtgtccgtcagcatccagccgatccaaaaatgttacaaatggtcctc
caagggtgtataggtactacagtaaatcgagggcctatggaaatggctacagtgttttta
gctccaccacgatatgataaaaacaccaacgatagaagtccagaaatcctagatgaatgt
tctgtgcaaccaccaccaccaccacgattacaaaacaaattacgactttgttttaaagat
ttttccaaaaagtaa

DBGET integrated database retrieval system