KEGG   Diuraphis noxia (Russian wheat aphid): 107164027Help
Entry
107164027         CDS       T04900                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00010  Glycolysis / Gluconeogenesis
dnx00562  Inositol phosphate metabolism
dnx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107164027
   00562 Inositol phosphate metabolism
    107164027
Enzymes [BR:dnx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107164027
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107164027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 107164027
NCBI-ProteinID: XP_015367190
Position
Unknown
AA seq 465 aa AA seqDB search
MKGQSSRVLLLLAFLFADLSGGESCYEPTDQDPYLYFSHKTAYQLIFNSKFKPVPYCRPT
FVWMFIRPGTSYPNTNESIAIRQLHQFKERVIKNHEERRNGHLCKHVLDSLKRWEFEVNP
TSEDDISPQGRMDMQLLAKRMKDKMSEVLVKEINQNTFKIYANEDRKVMNSAEEFSKTMF
GDDFRFKVPIEKIQKNSSFIGSESCPKWTDAVHXSEASLFRKSPEYLEMVSQMSKRLGFL
ENITDSIIHAMYESCRYNKALVIESYPAWCGLFTRQELQLLEYYEDLDYYYKYGYGSEIN
TKVGCPIARELMGYLNAVAKNDSVRPSAVFRFGSSAGLLTTLLALGVAKDTIPLTHSNYH
AQYRRQWRMSQVDPFSSNFAAVFYKCDQGDEENKVMFYLNEGVYDYPGCNVGLCSWKFVE
NKFKDYLTPNGCNDEVCHDRSQASGVRCAVLVTALIPIVLTYLHV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtcaatcatcaagagtattgctgttgctcgcgttcttgtttgctgatttgtct
ggcggcgaatcgtgctacgaaccaaccgaccaggatccatacctttatttttcgcacaag
acggcctatcaactgatatttaattcaaaattcaaaccggtgccttattgtcgcccgaca
tttgtatggatgtttatcaggcctggtaccagttatccaaatactaacgaatccatcgca
attcgtcagttgcatcaattcaaagaaagggtgataaaaaatcacgaagaacgtagaaat
ggacatttgtgtaaacacgtattagacagtctaaaacgttgggaatttgaagtgaatcca
acttcagaagatgatatttcaccccagggtaggatggacatgcagctactcgcaaaaagg
atgaaagacaaaatgagtgaagttttagtaaaagagatcaaccaaaatacgttcaaaatt
tatgccaatgaagaccgaaaagttatgaatagtgccgaggaattttctaaaactatgttt
ggrgacgatttcaggtttaaagttcctatcgaaaaaatccaaaaaaattctagttttatc
gggtcagagtcttgtcctaagtggactgatgcagttcacarttctgaagcttcgctgttt
cgtaaatcaccggaatatttggaaatggtgagccaaatgagtaaaagactgggttttcta
gaaaacataactgacagtataattcacgcgatgtacgaatcgtgccgatacaataaagcg
ctcgtgatcgaatcttacccagcatggtgtggcctgttcactagacaagagttacagctt
ttagaatattacgaagatttggactattactataaatacggttacggttctgaaataaac
acaaaggtgggatgtccgatcgccagagagctaatgggatatttgaatgctgtagcaaaa
aacgattccgtaagaccttcggcagtatttaggtttggttcttcagccgggttgttgact
acattattggctttgggcgtagcaaaagatacgattcctttgacccattccaattaccat
gctcagtatcgtcgtcaatggagaatgtcacaagtagacccattttccagtaattttgcc
gctgtattttacaagtgtgatcaaggtgacgaagagaacaaagtaatgttctacttgaac
gagggcgtgtacgattacccgggttgcaacgtcggtttatgctcttggaaattcgtcgag
aacaaattcaaagactatctgacaccaaatggctgcaatgacgaggtgtgtcacgaccga
agtcaagcgtcgggtgttcgttgcgccgttttggtcaccgcactgattccaatcgtactt
acgtacttgcacgtttga

DBGET integrated database retrieval system