KEGG   Diuraphis noxia (Russian wheat aphid): 107164166Help
Entry
107164166         CDS       T04900                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00450  Selenocompound metabolism
dnx00970  Aminoacyl-tRNA biosynthesis
dnx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107164166
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107164166
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dnx01007]
    107164166
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dnx03016]
    107164166
Enzymes [BR:dnx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     107164166
Amino acid related enzymes [BR:dnx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107164166
Transfer RNA biogenesis [BR:dnx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107164166
 Prokaryotic type
   Other AARSs
    107164166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 107164166
NCBI-ProteinID: XP_015367374
Position
Unknown
AA seq 683 aa AA seqDB search
MSLSTVEVGEFELLNAKNSWISKSCLKDINKIECQPVLPVKGEKNVLVTSALPYVNNVPH
LGNIIGCVLSADVFARYCRLRGWNTLYISGTDEYGTATETKALEEKLTPQQICDKFFKIH
NEIYKWFNISFDYFGRTTSNKQTEIVQEIFKEVHSNGYTSTASMEQLLCENCDRFLADRF
VEGTCPLCNYEDARGDQCDGCGHLINATELLKPRCKVCQKTPVIRSSQQLFLNLPKVEAK
LNDWIDKSGDDWSYNAKVITKSWLKDGLKERCITRDLKWGIPVPLEDFKSKVFYVWFDAP
IGYMSMSAVYTPEWRKWWQPEDDTEVTYYQFMAKDNVPFHSVMFPACLFATERNYTMVNH
IMATEYLNYEDGKFSKSRGIGIFGNDAQDTGLPADVFRFYLLFVRPESQDSSFSWADLAT
KNNSELLNNLGNFCNRALSFLEKFFDCVIPEIKLRDDELTLLALVTRDLKEYTSMLDKAK
LRDGLRLILSISRHGNQYMQFQKPWVLIKGSSEEKIRAGTVIGLSCNLVCLLAVMLQPYM
PQTVDVIGKQLNVDISTFLLNNFVSVFLQPGHKIGKPAPLFEKIDVSVVNQLKXRFAGKQ
ESQEKELPVASGLDLKQIISVEQIEEAISKQGDKVRKLKEAKVEKSELQPEINLLIELKS
KLCISKGIPVENGQKKKQKPNKK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtcgactgttgaagttggtgaattcgagttattgaatgcgaagaattcgtgg
atatccaaatcttgtctgaaagacatcaacaaaattgaatgccaaccagtattacctgtt
aaaggcgaaaaaaatgttcttgttacttcagcattaccatatgtcaacaatgttccacat
cttggtaatataattggttgtgttttatcagccgatgtttttgcaagatattgcaggttg
cgtggttggaatacattatacattagtggtactgatgaatatggcaccgcaactgaaaca
aaagcattagaagaaaaattaacaccgcaacaaatctgtgataaatttttcaaaattcat
aatgaaatatataagtggttcaatataagttttgattattttggaagaactacatcaaac
aaacaaacagaaattgttcaagaaatatttaaggaagtacacagtaatggctataccagt
actgcatctatggaacaacttttatgtgaaaattgtgatcgatttttagccgatcgattt
gttgaaggaacatgtcctctatgtaattatgaagatgcaagaggtgatcagtgcgatggt
tgtggtcatttaattaatgctactgaacttttaaaacctaggtgcaaggtttgtcaaaaa
acaccagttattcgtagttcccaacaactatttttgaatttacctaaagttgaagctaag
cttaatgattggattgataaatctggtgatgattggtcttataatgcaaaagtgattact
aaatcttggttaaaagatggtttgaaagagagatgcatcactagggacttgaaatgggga
attcctgtaccacttgaagacttcaagtcaaaagtgttttatgtttggtttgatgcacca
attggttacatgagtatgagtgctgtttatacaccagaatggcgtaagtggtggcaacca
gaagacgatactgaagtaacatactatcaattcatggcaaaagataatgtgccttttcat
tctgttatgttcccagcatgcctttttgctactgaacgcaactatacaatggtcaaccat
ataatggctacagaatatttaaactatgaagatggtaaattttctaagtcacgtggtatt
ggaatattcggaaatgatgctcaagatacaggattgcctgctgatgtttttagattttac
ttattatttgtacgtcctgaatcccaagatagttcatttagctgggccgatctagctact
aaaaataattctgaattgttgaacaatttaggaaacttttgtaatagagctttatcattc
ttagaaaagttttttgattgtgttattcctgaaattaaattaagagatgatgaactcact
ttattggcattagtaacgcgtgacctcaaagaatacactagtatgttggacaaggctaaa
cttagagatggattacgactcatactttcaatttctcgccatggtaaccaatacatgcag
tttcaaaaaccatgggtgttaataaaaggatcaagtgaagaaaaaatcagagcaggtaca
gttataggactgagctgcaatttagtgtgtttgctagccgtcatgctacaaccttatatg
ccacaaactgttgatgtaattggaaaacagttgaacgttgatatttctacatttttattg
aataactttgtatcagttttcttgcaacctggccataaaattggaaaaccagctccatta
tttgaaaaaattgatgtatcagttgtcaatcaattaaaaarccgctttgctgggaaacag
gaatcacaagaaaaagaattaccagtggcttctgggctggatcttaaacaaattataagt
gttgaacaaatagaagaagctatttctaaacaaggtgacaaagtacgaaaattaaaagaa
gcaaaagttgaaaaaagtgaactacagccagaaatcaatttattgattgaattgaaatcc
aaactgtgtatatcaaaaggcataccagttgaaaacggacaaaaaaagaaacaaaaacca
aataaaaaataa

DBGET integrated database retrieval system