KEGG   Diuraphis noxia (Russian wheat aphid): 107164506Help
Entry
107164506         CDS       T04900                                 

Definition
(RefSeq) legumain-like
  KO
K01369  legumain [EC:3.4.22.34]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107164506
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dnx01002]
    107164506
Enzymes [BR:dnx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     107164506
Peptidases and inhibitors [BR:dnx01002]
 Cysteine peptidases
  Family C13: legumain family
   107164506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 107164506
NCBI-ProteinID: XP_015367844
Position
Unknown
AA seq 444 aa AA seqDB search
MSSYQKLLKRVFNLVLLALFVIGSFAAHEPNSTNEENTIGKKWVFLVAGSDGWNNYRHQF
YERNPTPGKIINKPDGDNVYQGVKIDYKGKDVNKKNFLKIITGDKAGMRSIGTGRVIQGG
PLDRIFINFVDHGSTGLLSFPHDYLYADELNNAFNRMHGNKTYKKMLLYVEACESGSMFD
DILSENTNIFAVTAAGPRESSYACYCSRSETGYYRTCLGDLFSVKWMEDLDMHTSKLSAR
RRTIFNDFRVVRTNVSKSNVMIYGDLELGSEKLSSFIGYTGNDDVQSSYVKQSNEFNIKN
TVSSRDVYESNIQYGLAQDELSLSESLKLSAELRQNKEMRSVIDSVLRNIYSEVVKARPN
IKSEIGEYHEPKYLKLNLAMFPCYRSILNKITESCFSLPRNPYVLDHLTVFANMCVVDNQ
INQIVDSIVVQSCLDVPKNITNVQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagttatcaaaaacttttaaaaagagtttttaatttggtattattagcrttattt
gttattggatcttttgctgcacacgaaccgaattcaacaaatgaggaaaatactattgga
aagaaatgggtatttttggttgctggttcagatggatggaacaattacagacatcagttt
tatgaaaggaatccaacgccaggaaagatcatcaacaagcccgacggagataatgtttac
caaggagttaaaatcgactacaaaggaaaagacgtgaataagaaaaatttcctaaagatc
atcaccggtgacaaagcaggcatgcgatccattggaactggcagagtcattcaaggagga
ccactcgatagaattttcattaattttgtcgatcacggttcractggattattaagtttt
ccacatgattatttgtacgccgatgaactgaacaatgcgtttaatagaatgcatggaaat
aaaacttataaaaagatgttgttgtatgttgaagcgtgtgaatccggatctatgtttgat
gatatactcagtgaaaacacaaacatttttgcagtaaccgcggctggacctagagaaagt
tcatacgcttgctactgcagtcgttctgaaactgggtattaccgtacatgtctcggagat
ctgttcagtgtcaagtggatggaagatctagacatgcatacgtccaaactctcagcaagg
agacgaaccattttcaacgacttcagggtggtcagaacaaacgtmtccaaaagtaatgtc
atgatttacggagatttggagttaggaagcgagaaactatcttcgtttatcggttatact
ggaaatgacgatgttcagtcgtcatatgtgaaacagtcaaatgaattcaatattaaaaac
acagtatccagccgagatgtatacgagagtaacatacaatatggattggcacaagatgag
ttgtcgctttcggaatcgctcaagttgtcagcggagttacgtcaaaataaagaaatgaga
tccgtcatagactctgtattacggaacatttattcggaggtcgtgaaggcgagacctaac
atcaagagtgaaatcggtgaataccacgaacccaaatatttaaaactgaatttggccatg
ttcccgtgctacagaagcattttgaataaaatcactgagagctgcttttctttgccacgg
aatccatacgtcttggaccacttaacggttttcgctaacatgtgtgtcgtcgacaatcaa
atcaaccagatagtcgacagtattgtcgttcaatcatgtttggatgtaccaaaaaacata
acaaacgtacaataa

DBGET integrated database retrieval system