KEGG   Diuraphis noxia (Russian wheat aphid): 107165444Help
Entry
107165444         CDS       T04900                                 

Definition
(RefSeq) dual specificity protein phosphatase 10 isoform X1
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx04013  MAPK signaling pathway - fly
dnx04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    107165444
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    107165444
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dnx01009]
    107165444
Enzymes [BR:dnx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107165444
    3.1.3.48  protein-tyrosine-phosphatase
     107165444
Protein phosphatases and associated proteins [BR:dnx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    107165444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese SUIM_assoc Y_phosphatase PTPlike_phytase TFIIA Init_tRNA_PT Spt20
Motif
Other DBs
NCBI-GeneID: 107165444
NCBI-ProteinID: XP_015369196
Position
Unknown
AA seq 513 aa AA seqDB search
MKMRSDAPCSVRNKHRNTWGMKTLKMCFGKGRMKPRETIEQDLSMIGIAVPRLSVRSPSR
KRSLPTSTSTHDRFCSLKARQQRCSMSAVCYEGGVGGRSRAGLRLSLNRSISEPGPATPP
ITVTTPTTSKRFRLESIPSLPASLPASPNSDGTHLSGALILNKVKRMSSEYFRQKLELFG
PAILTIDCRSFVCYNVSHVRGAVNVNIADRINRRRLQTGKATLVELASSRDAKDALRRRG
YREIVVYDDSTTDLDRVPHNHPLMLILASLVDDEREPSFLIGGHKEFHSRHKDMCENSLL
PAPVSASCPPDVDRESMDTHPLTKVLPFLYLGNSKDADDRDGMTAIGVTRVLNVTTSQQS
PSPTMDHRASGVVYKRLSVLDNGHANLKQYFEEAFEFIEGARKSGGSVLIHCQAGISRSP
TIAIAYVMRHRKTSMVDAYKMVKAARPIISPNLNFMGQLLELEQSLQQYEQQQQQQQQQQ
QQQQQQQQQQPRCGQSWVAAQSAADELSPGFST
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcgaagtgatgcaccgtgttcagtacgtaataagcacagaaacacttgggga
atgaagacgttaaaaatgtgtttcggcaagggacgtatgaaaccacgtgagactattgaa
caagacttaagcatgataggaatagccgtacctagattaagtgttcgttcgccgtccagg
aaacgttcactaccaacttcaaccagcacgcatgaccgcttttgcagtttgaaagctcgc
caacaacgttgctccatgtcggctgtctgttacgagggtggagtcggtggtagatcccga
gctgggcttaggctcagtctgaacaggagtatcagtgagccgggcccagcaacaccaccg
attactgttactacaccgacaacctcgaaacgatttcgattggaatccatacctagtcta
ccggctagtttacccgctagtcctaattctgacggcacacatttaagcggtgctctaata
ctcaacaaggtaaaacgaatgagcagtgaatattttagacaaaaattggaacttttcggg
ccagcgattttaaccattgactgtcggtcttttgtatgctataacgtcagtcatgtgaga
ggtgctgtgaacgtgaacatcgccgaccgtatcaacagacggagattgcaaactggaaaa
gccactttggtggagttggcgtcatctagggatgccaaagacgccctcaggaggcgtggt
tatagagaaattgtggtgtacgatgactcgactacagatttagacagagtgcctcataac
catcctctgatgctaatccttgcatcgttagtagacgatgaaagagaaccatcgtttctt
atcggtggccacaaagaatttcattcccgacacaaggacatgtgcgagaattccctgctg
ccagcgccggtgagcgccagctgccctccagatgtggatcgcgagtctatggacacccac
cccctgaccaaggtgctgccgttcttgtacctcggtaacagcaaggatgccgacgaccgg
gatggtatgaccgctatcggagtaacccgtgtgctgaatgtgactacgagccaacagtca
ccatccccgactatggaccatcgcgcttctggcgtagtgtataagcgactttccgtctta
gacaacgggcatgccaacctcaaacagtatttcgaggaagctttcgaattcatcgaaggc
gctcggaagtccggcggaagtgtrctgatacactgccaggccggcatatcacggtcgccg
accatagccatcgcgtatgtgatgcgccaccggaagacgtccatggtggacgcatacaag
atggtcaaggcagctaggccgatcatatcgccgaaccttaactttatgggacagctgctg
gagttggaacagagcttacagcagtacgaacaacaacagcaacaacaacaacaacagcag
caacaacaacaacagcagcagcagcagcaaccgcgttgcggacagtcttgggtcgccgcc
caatcggccgcagacgaactgtcgcccgggtttagcacataa

DBGET integrated database retrieval system