KEGG   Diuraphis noxia (Russian wheat aphid): 107165967Help
Entry
107165967         CDS       T04900                                 

Definition
(RefSeq) adenylate kinase 9-like
  KO
K18533  adenylate/nucleoside-diphosphate kinase [EC:2.7.4.3 2.7.4.6]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00230  Purine metabolism
dnx00240  Pyrimidine metabolism
dnx01100  Metabolic pathways
Module
dnx_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
dnx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
dnx_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107165967
   00240 Pyrimidine metabolism
    107165967
Enzymes [BR:dnx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     107165967
    2.7.4.6  nucleoside-diphosphate kinase
     107165967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK YHS Dimer_Tnp_hAT AAA_17 AAA_18 zf-FCS CobU
Motif
Other DBs
NCBI-GeneID: 107165967
NCBI-ProteinID: XP_015369919
Position
Unknown
AA seq 1890 aa AA seqDB search
MADGKIQYQAKLTLLLHQNCDTMFCDNTFGEALDGIFPNVEIILRMYLSTAVSNCTGERS
FSVLKRMKDYMRSSMKNDRLNALSRLRQDTDTNSTTDSIVWPSSTRRFSSGDCEILGHDQ
TADDDTWYPRVVSSYAVTERVNWLRHLEADAEHRCXRSPAAVRRWSRAVQAVDHDYYGSE
DVDEAFLRRKPVSFVIFGKPGLADDRLATMLSAHWGCVHVSAATGLLAASLRPNDQIGLA
LRRGEAVNAADSTSLLVSLLGIGGIEVQERGYVLTGLPRQNPKLSACEQMAAVFTTNPPD
VLIYMSCRNQDLSHIHNGLTLESMEHDHLTQTLHMNDVECNHKRVHWYNKLFINKKVIEL
DVKDYENYSMRVIDEIIKQFNPERVITLDGRKPVNELIETIKTKLMTMSLQYTVLPKIVQ
FQDKSVSSKSYAYSGSEFEFESESNEAETAASNEERSSDMTQLHDENLHSINDRNEQIRV
TSEFGRLCPVNYFNGKFIKGSVRYCMKFMGKSYYFAGPDEMQLFGKCPKQFLKVMGYRLP
IRAIFYGPQTLTNPAAKAVRKFLGYNLIDVGYLTEIHEKETRHAYSSVIVSAILKTAQKI
IEPKEIQLNDMSILRNAIADWTRLRFDVIIKSDLNGVEHEESEYEMYEDFSNQKEHDVEE
LFKKRQLMRLKNYFESYDIDFLDDSNECIRAYDEPEMNAPINVVLVNKLIDEGLNPIQMI
FFHDSDPNHSVLLSNDEMSDSFRNNYKNILENLKIGKKHGTAVERIKYPEFFNENENPLD
ISYERITKNDSFEEEIEIAEHEEDKDVNYISHDHLLGIIVPEITERLNQYTENLLVQWHT
LKKQISKETNQNMNFNTIECRPNSTTNLLKILIEDTLCYIKKFLTDNVYDISTSDIEETV
PTRGKYDGDTSIYCPVRFANGKLSIGSKKHMAIYHNRYYYMSSLDNFKAFISNPNKYTLF
TSIPKTYPKPKISLLFSFGLSSVDLINEILKTFDLTLVDSYKVFKQNVLPKNLPMVGKMY
EEPTLKEIVDKCFIHVNHKDHINSLRKYMDKESAYLNDEDWFKMNSIFFQADEGICYKNY
PKSLTELKYLKENEINPDVIIEIIPEKHIAKEHANASVIQNWLTYQYVLIEMIIAQDNET
RRNTVNNRSILFKQKLAELTKQKEINKVKIRLEGIIKMIAAETMVEGPKVVKSICDSQNQ
SNKSFRKSATVPISDFLSRYSELTLKQKKIIIDRGLNVGDFMDLDDFTTLDEIDETVKDK
FPDDDYMISKCFSDGFAFPSNAMIERFLDMEKSALAEMRKFAENSNIPWIMISDPDARSA
AMSDIADVLKINTDAPFESPYEVDLETTEEMLRNGEVHLSRFGRWCPVQAVRYTANPSIR
RFCPDPADGHVHTVVHRKYVYFVAGGINNRDEFMRWPMKYVLAQSTMPLPRPSFQLKIAV
VGPPRSGKSRCAQELCSRYGLQLIRIEDAIETYLTEYRWTDMAKTAKGTLRRGDALSEEM
LVEVVTTAMFDGRATTWGYVIDGYPVTKKQFKLLDGAGVILHAVFVLQDNGLPEESIEND
TALLRLRRGAWKTAFSGLPWISARYGNATGFAATDTDGMAEAASACVRSMLAYQTDLHCN
RPTRLSGVPVTGREYQYDLSTFLDQCPVCKVDCDRLFRPLNPAVMRRSSVQYQAYIYWMC
GPEHEAAFADNPDRYADAAPITPYPHPESTTDSMLSRNPYFMYSLSSEYCAVCVLSCLWY
PEYKRGRPELMVTYGNRSYTFCSSQCKREFSQQPSMYAEYTMRVSGPEQPLSSSTWSWSQ
DQLDRLPVPGYLEQTVSALVSSALTELTAIKPVYPGLTLEVSAMLYLGLHXGMNGSCDKD
VAEYYRNAFKRFVETCQSFKIESLKLKSLM
NT seq 5673 nt NT seq  +upstreamnt  +downstreamnt
atggccgatggtaaaatccaatatcaagcaaaactaacccttttgttacaccaaaactgt
gacacgatgttctgtgataatacttttggtgaggcattagatggaatctttccaaatgtg
gaaataattttaagaatgtacttaagtactgctgtttctaattgtacgggagagaggtct
ttttcggtgttaaaaagaatgaaagattatatgagatcttcaatgaaaaatgaccgttta
aatgcactttctcgattacgacaagacaccgatactaactcaacgacwgactcgatcgtg
tggccatcgtcgactcggcggttcagctcgggtgactgcgaaatcttaggacacgatcag
acggccgacgatgacacgtggtacccacgggtggtatcgtcctacgcggtcaccgagagg
gtcaactggttgaggcatctggaagcggacgcggaacacaggtgccrtcggtcaccagcc
gccgttagacggtggtcgcgggcagtacaggcggtggatcatgactattacgggagcgag
gacgtggacgaggcgttcttgcggcggaaaccggtttcgtttgtgatattcggcaagccc
ggtttggcggatgacagactggccacaatgttatcagcgcactggggatgcgtccacgtg
tccgcggccaccgggctgctagctgccagtctccggccaaacgaccagataggtttggcg
ttacggcgcggtgaagcggtaaacgccgcggattccacctcactgctcgttagccttttg
ggtatcggagggattgaggtacaagaaaggggttacgtgctgaccggacttcccaggcag
aatccgaaactgagtgcatgtgaacaaatggctgcggtgttcactacaaatccaccagac
gtattgatttatatgagctgtcggaatcaggatttaagccatatacataatggattgact
ttagaatctatggaacatgatcatcttactcaaacactacatatgaatgatgtggaatgc
aaccacaaacgagtacattggtacaataagttatttataaacaagaaggtgattgaactg
gatgtgaaggattatgaaaattattcgatgagagtaattgacgaaataataaagcagttc
aatccagaacgcgtgataaccttggacggtagaaaaccagtcaacgaattgatagaaaca
attaaaacaaaattaatgacgatgtcactgcaatacacagtattaccgaaaatcgtacag
ttccaggataaatcagtttcgtccaaaagttacgcgtatagtggttctgaattcgaattt
gaatcggaatcaaacgaggcggaaactgcggccagcaaygaggagcgatcgagcgatatg
acccaattacacgacgaaaatttacacagcattaatgatcgtaacgagcaaatacgtgta
acgtcagaatttggtcgtctgtgcccagtgaactattttaacggtaaattcataaaggga
agtgtacgttattgtatgaaatttatggggaaatcgtattactttgctggacccgatgaa
atgcaattattcggtaaatgtccaaaacaatttttgaaagtcatgggatatcgattaccg
attagagccatattctatggtccacaaacgttgacgaatccggctgcaaaggctgtacgc
aaattcttaggttataacttaatagacgtcggatacctaacagagatacatgaaaaagaa
acaaggcacgcgtattcatctgtgattgttagcgcgatacttaaaaccgcacagaagatc
attgaaccgaaagaaattcaacttaatgacatgagcatattgcggaacgcaatcgctgat
tggacacgtctacggtttgatgttattattaaatctgatttaaatggtgtggaacacgaa
gaaagtgaatacgaaatgtatgaagatttttcaaatcaaaaagaacatgacgtggaagaa
ttattcaaaaagaggcaattaatgcgtctaaaaaactactttgaatcatatgacatagat
tttttagatgattccaatgaatgcattcgtgcttatgatgaaccagaaatgaacgcacca
ataaatgttgtattagtgaacaaattaattgatgaaggccttaatccaatccagatgata
ttttttcatgattccgatccaaatcacagtgtactattatcaaatgacgaaatgtccgac
agttttcgaaataattataagaacattttagaaaatttgaaaattggcaaaaaacatgga
actgcagttgaaagaataaaatatccagaatttttcaatgaaaatgaaaatccgttagat
atttcttatgaaagaataactaaaaatgattcttttgaagaagaaattgaaattgcggaa
catgaggaagataaagacgtgaattacataagtcacgatcacctattgggaataatcgtt
ccagaaataactgagcgattaaatcaatatacggaaaatcttctcgtacaatggcatact
ttaaaaaaacaaatttctaaagaaacaaaccagaacatgaattttaatactatagaatgt
agacccaactctacaacaaatttgctgaaaatattaatcgaagacactttatgttatata
aagaagtttttgacagataatgtatacgatatatccacatcagatatcgaggagactgtt
cccacgagaggaaaatatgatggtgatacttccatctattgccccgttaggtttgcaaat
ggtaaactgtctatagggtctaaaaaacacatggcaatctatcataataggtattactac
atgagctcgttagacaattttaaagcctttatttctaatcctaataaatatacgttgttc
actagtatcccaaaaacataccctaaacccaaaatatctttacttttttcatttggtctc
agttcagtagatttgattaacgaaatattaaaaacatttgatttgactcttgtagactct
tataaagtatttaaacaaaacgtattaccaaaaaatttgccaatggtgggtaaaatgtat
gaggaaccgacgcttaaagaaattgtggataaatgttttattcatgtaaatcataaggat
catattaacagcctgagaaaatacatggataaagaaagtgcttacttaaacgatgaggac
tggtttaaaatgaattcgatattttttcaagccgatgaaggaatatgctataaaaattac
ccaaaaagtttgacggaactgaagtatctaaaagaaaatgaaataaaccctgacgttatt
attgaaataattcctgaaaaacacatcgcaaaagaacacgccaacgcatcagtcattcaa
aattggttgacttaccaatatgtattaatagaaatgatcattgcgcaggataacgagaca
aggcgaaacactgttaacaacagatcaatattgtttaaacaaaaactagcggagttaacc
aaacaaaaagaaatcaacaaagtaaaaattcgtttagagggtataatcaaaatgattgca
gcagaaacaatggtagaaggaccaaaagtggtgaaatccatttgcgacagtcaaaatcaa
tcgaataaatcttttcgtaaatctgcaactgtccccatttcagattttttatccagatat
tcagaacttacgttaaaacagaaaaaaatcatcattgaccgcggattaaatgtaggcgat
ttcatggatttggacgactttacgacattggatgaaatcgacgagacggtcaaagacaaa
ttccctgacgacgactacatgatatccaaatgtttttcagatggctttgcattcccgtca
aatgccatgattgagagattcctggacatggagaaatctgcgttggcagaaatgcgtaag
tttgccgaaaactccaacattccgtggataatgatttctgatccggatgcccgatcggct
gcgatgagtgatatcgccgatgtgttgaagataaacaccgacgcgcctttcgagtcacct
tacgaagtggatctggagaccacagaggaaatgttacgcaatggcgaagtgcacctgagc
cggttcggtcggtggtgcccggtgcaggcagtacggtatacagccaacccaagcatcaga
cgattctgtccagatccagctgacggtcacgtccacacggtcgtccaccgcaagtatgtg
tactttgtagccggtggtataaataacagggacgagttcatgcggtggcctatgaaatac
gtgctcgcacagtctacgatgccactaccgcgaccgagtttccaattaaagatcgcagtg
gtcggaccacccagaagcggaaagtcacgttgcgcacaagaactgtgctcccggtacgga
ctgcagctaatccgaattgaggacgccatcgaaacgtacctgacggagtaccgatggacg
gacatggcgaaaacagccaagggcacgctacgccggggtgatgcgttgtccgaggaaatg
ctggtagaagttgtgactacggctatgttcgacggccgagccaccacgtggggctacgtg
atcgacgggtacccagtgaccaagaagcagttcaagctgttggacggtgccggggtcatt
ctgcacgcggtgttcgttttacaagataacggtctgccggaagaaagcatcgaaaacgac
actgcattgttgcggctcagacgcggcgcttggaagacggcgttttcaggtctaccttgg
atatcagcccgatacggkaacgctaccggttttgcggccaccgacaccgatgggatggcc
gaggccgcgtcggcgtgcgtccggtcgatgctcgcgtaccagacggacctccactgcaac
cgcccaacccggctgtcgggcgtgccagtaacgggccgagaatatcagtatgacctgagc
accttcctggaccagtgtccggtgtgcaaggtagactgcgaccgcttgttccggccacta
aatccggcggtcatgaggcggtcctcggttcaataccaggcgtatatctactggatgtgc
ggcccggaacacgaagccgcattcgccgataatccagatcggtacgcygacgcggcaccc
atcacgccttacccccatccggaatccaccaccgacagtatgctgtcccggaacccgtat
ttcatgtatagtctgtcgtccgagtattgcgcggtatgcgtgctatcgtgcctgtggtat
ccggagtacaaacgcggacgtcccgagctaatggtcacctacggtaatcgctcatacacg
ttctgctcgtcccagtgcaaacgggagttctcgcagcagccgtccatgtatgcggagtac
acgatgcgcgtcagtggccctgaacaaccgttatcatcgtcaacgtggtcctggagccag
gaccaattagacagactgcctgtacctggctacytggaacagaccgtgtccgcrctcgtc
agttcggcgctgaccgagttgacagccatcaagcccgtatacccgggcctgacgctcgag
gtttcggccatgctgtatttaggcctgcacrtcggcatgaacggcagctgtgacaaagac
gtggccgagtactaccgcaacgctttcaagcggttcgtagaaacctgtcaaagtttcaaa
attgagtcgctcaaattgaaatcgttgatgtga

DBGET integrated database retrieval system