KEGG   Diuraphis noxia (Russian wheat aphid): 107166331Help
Entry
107166331         CDS       T04900                                 

Definition
(RefSeq) protein henna
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00360  Phenylalanine metabolism
dnx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dnx00790  Folate biosynthesis
dnx01100  Metabolic pathways
dnx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    107166331
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    107166331
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107166331
Enzymes [BR:dnx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     107166331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT DUF5370
Motif
Other DBs
NCBI-GeneID: 107166331
NCBI-ProteinID: XP_015370421
Position
Unknown
AA seq 453 aa AA seqDB search
MMNGHATVIENNLGTPKIRKGSYIAPIDEESITLIFSPGNDSVGTLAKALKLFKEYNVNL
LHIESRSSDRIPDQYEFFVECAPGGNVPKVVEILKGTMTYCSVVSRNKLKDSKVKDNYVP
WFPLRIRDLDKYANQILSHGAELNADHPGFTDPVYRMRRKYLADTALNYRHGDPLPYIEY
TEQEVKTWGTVFRELTKLYPTHACNEYNHVFPLLVENCGYREDCIPQFEDISNFLKDSTG
FTLRPVGGLLSSRDFLAGLAFRVFHSTQYIRHHSRPLYTPEPDICHELLGHVPLFANPAF
AQFSQEIGLASLGAPDDYVKKLATCYWFTVEFGLCRQNGELKAYGAGLLSSIGELQYSLS
GKPELKSFDPEVTGNQDYPITEYQPTYFVAESFDDVKDKLIKFAKTIPKQFGIRYNPYTQ
SVQVLDSKLQLQELANNISNELQILRYTLNKMD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacggacacgctacagtgatagaaaataacttggggacacctaagatacgcaaa
ggatcatatatagctcctattgatgaagaatccatcacattgatattttcaccgggaaat
gatagcgtcggaacactggctaaggcattaaaactcttcaaggaatacaacgtgaacctg
ttgcatatagaatcccggtcgtcggacaggataccggatcagtatgagttttttgtcgaa
tgcgcgcccgggggtaacgtcccaaaggtggtagaaatattgaagggcacaatgacatac
tgttcggtagtgtccaggaataaactcaaggacagcaaagtgaaagacaattacgttccg
tggttcccgttgcggattagggacttggataagtacgccaatcagatcctatcgcatgga
gctgaactgaacgccgatcatcccgggttcacggatcctgtgtacagaatgaggaggaag
tatttggcagataccgcgttgaattatagacatggagatccattaccttatatcgagtac
accgaacaagaagtgaagacttggggtaccgtgttcagagaactaactaaattgtatccg
acgcatgcgtgcaatgaatataatcacgtgtttcccctgttagttgaaaactgtggttat
cgagaggactgcataccgcagttcgaagatatttccaattttcttaaggacagtaccgga
tttactttaagaccagttggtggacttctttcgtccagagacttcttagccggattagct
ttcagagtattccattccacacaatacatcagacaccatagtcgaccattatacacgcct
gaaccggacatttgtcatgaactgttgggccatgtaccgttgttcgctaacccagctttt
gcacaattttctcaagaaattggactggcgtcgcttggcgcccccgacgattacgttaaa
aaattggccacgtgttattggttcaccgtcgagttcggactgtgccgtcagaatggcgag
ctgaaggcgtacggcgccggactgctgtcgtcgatcggtgaactccaatactcgttgtca
ggcaaaccggagctgaagtctttcgatcccgaggtgaccggcaaccaggattatccgatc
accgagtatcagcccacatatttcgtcgcygagagcttcgacgacgtcaaggacaaactt
ataaaatttgcaaagacgataccgaaacaattcggaatccgctacaacccgtacacgcag
agcgtgcaggtgctggactcgaaactgcaactgcaagagctggccaacaacatcagcaac
gagctacagatattgcgctacacgctcaacaagatggattga

DBGET integrated database retrieval system