KEGG   Diuraphis noxia (Russian wheat aphid): 107168837Help
Entry
107168837         CDS       T04900                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial-like
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00071  Fatty acid degradation
dnx01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107168837
Enzymes [BR:dnx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     107168837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CH
Motif
Other DBs
NCBI-GeneID: 107168837
NCBI-ProteinID: XP_015373853
Position
Unknown
AA seq 294 aa AA seqDB search
NILNPQLLLSKIQYILNEDIAPSNHPIGVLTTTERNNWADLRNHLIKLGNEESLRIIDDS
ILMIALDDEKPGSDPISCVKQYLHSDGINRWFDKSFTLIVCADGTSGLNFEHSWGDGVAV
LRYFQDISKDSTNFPKCHPENLNQVLTSVDAFDVKKLVKLYKKHVGTYESCSTAAFKHGR
TETVRPCTMKTADFCYAVSSNNKPSNNDLVNMIKQCSVEHSKLVKEAAMGQGFDRHLFAL
RLLAKESNLKIPDLFTDPAYGLINHNILSTSSLTSDYVWLGGFGPVIKDGYGIG
NT seq 887 nt NT seq  +upstreamnt  +downstreamnt
gaaatatattaaaccctcagttattattatccaaaattcaatacattttgaatgaagaca
tagctccatctaatcatccaatcggcgttttaacaaccactgaacgtaataattgggctg
atttaagaaatcatcttatcaaattaggaaatgaagagtcattgcgtataatagatgata
gtattcttatgattgctcttgatgatgaaaaacctggttctgatccaatatcatgtgtta
agcaatatctacattctgatgggatcaacaggtggtttgacaagtcattcacattaatag
tatgtgctgatggaacatcaggattaaattttgagcattcgtggggtgatggagttgctg
tgttgagatattttcaagatatttctaaggattctactaactttccaaaatgtcatcctg
aaaatttaaatcaagtattgacatcagtagatgcattcgatgtgaagaaattagttaaac
tatataagaaacatgttggtacttatgaatcatgcagtacagcagcattcaaacatggaa
gaacagaaactgtaagaccgtgtacaatgaagaccgctgatttttgctatgctgtatcaa
gtaataataaaccctctaacaatgatctagtgaacatgataaagcaatgttcagttgaac
atagtaaacttgtaaaggaagctgcaatgggacaagggtttgatcgtcatttattcgctc
tacgattattagctaaagaaagcaatttaaaaattccagacttgttcaccgatcccgctt
atggtcttattaatcataatattctatctacttctagtttaacttcagattatgtatggt
tgggagggtttggtcctgttataaaagatggttatggaattgggtaa

DBGET integrated database retrieval system