KEGG   Diuraphis noxia (Russian wheat aphid): 107169340Help
Entry
107169340         CDS       T04900                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00350  Tyrosine metabolism
dnx00360  Phenylalanine metabolism
dnx00380  Tryptophan metabolism
dnx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107169340
   00360 Phenylalanine metabolism
    107169340
   00380 Tryptophan metabolism
    107169340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnx04147]
    107169340
Enzymes [BR:dnx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107169340
    4.1.1.105  L-tryptophan decarboxylase
     107169340
Exosome [BR:dnx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107169340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 107169340
NCBI-ProteinID: XP_015374549
Position
Unknown
AA seq 517 aa AA seqDB search
MDSETFRECGKMVIDYIADYLDNIRDRPVLSTVKPGYLYELVPPEAPIKGEDWKTVLADV
ENIIMPGITHWHSPQFHAYFPTGBSYPAIIGDMLSSGIGSIGFSWITSPACTELEVQVMN
WFGKILDLPKEFLNESKGPGGGVLQGSASESTFVCLLAAKDRTTKRIKSLHPNMTDGEIK
AKLVAYTSDQSNSSVEKAGLLGSMPMRMLKADKSGRMTGFILSEAIAEDVSKGLIPCYVV
ATLGTTGICAFDNLEELGPICNENNIWLHVDAAYAGAAFVLPEYRYLMAGVQFADSFDVN
LHKWLLVNFDCSALWVKNSTYLVDAFNVDRVYLXHRYQSLDPQVPDYRHWQIPLGRRFRS
LKMWFVLRLYGVEGLQAHIKKQVQLADLFGKFVNQDPRFEVVTVTMGLVCFRLKGDNVLT
KNLHERLMASGQIYLVTATVRSRLVIRFVVCSRLTEEVDVQFAWNEIRAQADRVEGERDM
VPTNICNSRTGAWPKDKADCEELTAATPIVVKSLTKG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggattccgaaacgttcagagaatgtgggaagatggtcatcgactacattgcagactac
ttagacaacatccgagacaggcccgtcttgtccaccgtcaaaccgggatatctttatgaa
ttagtgccgcccgaggctccgattaaaggtgaagattggaagacggtgttggccgacgtg
gagaacataatcatgcctggcattacacactggcactcaccgcagtttcatgcgtatttc
ccgaccggaractcttatcctgccatcatcggtgacatgctgagcagcggaatcggatct
ataggattttcttggattacgagtccagcgtgtaccgaactcgaagtgcaagttatgaat
tggtttgggaaaatcttggacttgccgaaagaatttttgaacgagtccaaagggcccggt
ggtggcgtccttcagggtagtgccagcgaatccacattcgtgtgcctgttagcagccaaa
gaccgcacgacgaaacgaatcaaatcactccacccgaatatgaccgacggtgaaatcaag
gcaaaactggtagcctacacttccgatcagtccaattcgagcgtggagaaagccggtctc
ttgggatcgatgccaatgaggatgctcaaggcggacaagagcggtcggatgaccgggttc
atactatccgaagccatagctgaagatgtctccaaagggttgataccatgttacgtggtc
gccacgttgggaaccactggcatttgcgcgtttgacaatttggaggagctcgggcccatc
tgcaacgaaaacaacatttggctgcacgtcgacgccgcttacgcaggtgccgcattcgtg
ttaccggaatacagatatctgatggcgggagtgcaatttgcggactcgttcgacgtcaat
ttgcataagtggctcttggtgaactttgactgttcagccttgtgggtgaagaactcaact
tatttagttgatgcgtttaacgtggaccgagtttacttgaakcaccgctaccagagtctg
gatccccaagttccggattacagacattggcaaataccgttgggccgaaggttcagatca
ttgaaaatgtggttcgtgctaagactgtatggcgtggagggtctacaggcacacatcaaa
aagcaggttcaattggctgacttatttgggaagttcgtcaaccargacccaaggttcgaa
gtcgttaccgtcaccatgggactggtttgctttcgattgaagggtgacaacgtcttgaca
aaaaaccttcacgagcgactgatggcgagtggacaaatatacctggtcacggccaccgtc
cggtcgaggttggtcatacggtttgtggtctgtagccgactgacggaagaagtcgacgtg
cagttcgcgtggaacgagatacgcgcgcaggctgaccgcgtggaaggtgaacgcgacatg
gtgcccacaaacatttgcaacagccgtacaggagcgtggcctaaagacaaggcggactgc
gaggaactcaccgctgccactccaattgtagtcaagtctctgaccaaaggatga

DBGET integrated database retrieval system