KEGG   Diuraphis noxia (Russian wheat aphid): 107169986Help
Entry
107169986         CDS       T04900                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00480  Glutathione metabolism
dnx00590  Arachidonic acid metabolism
dnx00980  Metabolism of xenobiotics by cytochrome P450
dnx00982  Drug metabolism - cytochrome P450
dnx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107169986
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107169986
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107169986
   00982 Drug metabolism - cytochrome P450
    107169986
Enzymes [BR:dnx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107169986
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     107169986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C GST_N_3 GST_N_2 GST_N_4 GST_C_2
Motif
Other DBs
NCBI-GeneID: 107169986
NCBI-ProteinID: XP_015375451
Position
Unknown
AA seq 204 aa AA seqDB search
MTYKLTYFNFTALGEPIRFLLSYLDIDFEDNRIEIEEWPSVKHTMPYGTVPLLXIDGKVL
NQSSAICRYLAKKANLAGSDDWESLLIDIAVDNFKDFGLCLKSYWFDPNAESKAAKYVTL
VNETIPYYMDKFENIVGENNGYLVNGKLSWADIFFVSILDHLIYRVNIDILKDRPNLQAL
KEKVLAVPKIKSWIEKRPLSFDIA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaaattaacatacttcaacttcactgcactaggcgaacccatacgattcctg
ctgtcttatttggatattgatttcgaagataaccgtatcgaaatcgaagaatggccatca
gtcaaacacaccatgccatatggtacagttccattgttggmaattgacggtaaagtattg
aatcaatcttcagccatctgtcgttatttagctaaaaaggctaatttagctggtagcgat
gattgggaatccttattgatagacattgctgtagataattttaaagattttggtttatgc
ttgaaatcttattggtttgatccaaatgcagaatctaaagctgctaaatatgttacgctg
gtcaatgaaactataccatattatatggacaagtttgagaacatwgttggtgaaaataat
ggatatctcgtgaacggaaagttatcttgggctgatatattttttgtgagtattttggac
cacttgatatatagagtaaatattgacatattgaaagatcgcccaaacttacaagctctc
aaagaaaaggtattggcagtacccaagattaaatcatggattgaaaaacgaccattatct
tttgacattgcataa

DBGET integrated database retrieval system