KEGG   Diuraphis noxia (Russian wheat aphid): 107172914Help
Entry
107172914         CDS       T04900                                 

Definition
(RefSeq) septin-7-like isoform X1
  KO
K16944  septin 7
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dnx04131]
    107172914
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dnx04812]
    107172914
   04147 Exosome [BR:dnx04147]
    107172914
Membrane trafficking [BR:dnx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    107172914
Cytoskeleton proteins [BR:dnx04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     107172914
Exosome [BR:dnx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107172914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Dynamin_N Gtr1_RagA ABC_tran AAA_22 AAA_29 FtsK_SpoIIIE AAA_16 NB-ARC Ras
Motif
Other DBs
NCBI-GeneID: 107172914
NCBI-ProteinID: XP_015378711
Position
Unknown
AA seq 504 aa AA seqDB search
MINGESGGDGVNGAGVAKPTPPPTLPKSYTPSAAAAYRLASMERLAQRQRIFEQGGPPPP
PSSTAXVAATTVTTAAATASDDHQHHQSSPVGPPPPVTAPKPVLGTKLQSKRELFFKNDV
SANSGTPSTVQSNTSSTSPVPHQNSVTSIKTNQSTNLPSTAPMNLPRAPVKVESSMEPTE
NKEKLLKTDQSGTGKVNDRKVKKLDGYVGFANLPNQVYRKAVKKGFEFTLMVVGRSGLGK
STLINTMFLADIYGKEHPGPSLRVGKTVRVETNRCMLKEKGVNLSLTVVDTPGFGDAVDN
SDCWQPVLEYIESRYEEYLNAESRVNRKLQHDSRVHCCLYFLESNSHGMTPLDVEFMQRL
HDKVNIIPIISKADTMTPDEVTEYKKQILKEIAQHKIKIYDFPDSDKDEDRENLKKLKAR
VPFAVVGSTEVHEVDGKKVRGRKYPWGLVEVENLDHCDFVALRNMLLRTHLQDLKEVTSN
VHYENFRFRKLACFSADGPKGMTK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacggcgaaagcggcggcgacggcgttaacggcgccggagtagccaaaccgacg
cccccgccgacgttgcccaagtcgtacacgccgagtgcggcggccgcgtaccgtttggcc
agcatggaacgcctggcccaacgtcagcggattttcgaacagggtggaccgccgccgccg
ccttcttccactgcckccgtcgccgccactaccgtcaccaccgccgcggcgacagcgtct
gacgatcaccagcaccaccagtcgtcaccggtcgggccgccgccacccgtcaccgcgccc
aaacccgtgctcggcaccaagctgcaaagcaaacgagagttattcttcaagaatgacgtt
tcagcaaacagtggaactccgtctactgttcaatcaaataccagttcaacttcccctgtg
ccccatcagaactctgttaccagtataaaaaccaatcaaagtacaaatttaccatcaact
gctccaatgaatttaccacgagcacctgttaaagtcgagtcatcgatggagcctacagaa
aataaagaaaaacttttaaaaacagatcaatcaggaactggaaaggttaatgataggaaa
gtgaaaaaattagatggatatgttggatttgctaatttacccaatcaagtatatcgcaaa
gctgtaaagaaaggctttgaatttactctcatggttgttggtagatcgggtcttggaaaa
tccaccctaattaacacaatgttcttagctgatatatatggcaaagaacatcctggtcct
tctttacgtgttggtaaaacagtacgagttgaaactaacagatgtatgttaaaagaaaag
ggtgtaaatctttcacttacggtagttgatacaccaggatttggtgatgctgttgacaat
tcagattgttggcaaccggtgctcgagtatattgartcaaggtatgaagaatacttaaat
gctgaatctagagttaatagaaaattacaacatgatagccgtgtacattgttgcttatat
tttttggagtcwaatagtcatggaatgactccattagatgtagagtttatgcagagactt
catgacaaagtgaacataattccmatcatttcwaaagcagatacaatgactccagacgaa
gtaacagagtacaaaaaacagattttaaaagaaattgcccagcataaaatcaaaatttac
gatttccctgattctgacaaagatgaagatcgagaaaatttaaaaaaacttaaggcacgt
gtaccatttgctgttgttggttcaaccgaagttcatgaagtagatggaaagaaagtacgt
ggacgaaagtatccttggggtttagttgaagtggaaaatcttgatcactgtgattttgtt
gccctaagaaatatgttgttgagaacacatttacaagatctaaaagaagtgactagtaac
gtacattatgaaaacttcagatttagaaaattggcttgcttctcagctgatggtcccaaa
ggcatgaccaagtga

DBGET integrated database retrieval system