KEGG   Diuraphis noxia (Russian wheat aphid): 107173185Help
Entry
107173185         CDS       T04900                                 

Definition
(RefSeq) succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial-like
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
dnx  Diuraphis noxia (Russian wheat aphid)
Pathway
dnx00020  Citrate cycle (TCA cycle)
dnx00640  Propanoate metabolism
dnx01100  Metabolic pathways
dnx01200  Carbon metabolism
Module
dnx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dnx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dnx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107173185
   00640 Propanoate metabolism
    107173185
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnx04147]
    107173185
Enzymes [BR:dnx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107173185
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107173185
Exosome [BR:dnx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107173185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 GARS_A ATP-grasp ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 107173185
NCBI-ProteinID: XP_015379098
Position
Unknown
AA seq 124 aa AA seqDB search
MSQFMKHIIKCNISQTYLQYFPLKNIQARHLNLLECHSKDLLNQHGVSVQKFKIVENADE
TNNLLKSFDVEEYVLKAQVLAGGRGKGHFSNGFKGGVHVTKERPYKVGQVDHVQLSKPYL
LYIL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaattcatgaaacatataattaaatgcaacatttcacaaacatatcttcaatat
tttccattaaagaacattcaagctcgacatttaaatttattagaatgtcatagcaaagac
ttattgaatcaacatggagtctcggttcaaaaatttaaaattgtggaaaatgcagatgaa
acaaacaatttgttaaaatcatttgatgtagaagaatatgtattaaaagctcaagtattg
gcaggggggcgaggaaaaggccatttcagtaatggattcaaaggaggcgttcatgtcaca
aaggagcgaccgtacaaagtaggccaggtggaccatgtccaactctctaaaccatacttg
ttatatatattgtga

DBGET integrated database retrieval system