KEGG   Desulfomicrobium orale: AXF15_02715Help
Entry
AXF15_02715       CDS       T04289                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
doa  Desulfomicrobium orale
Pathway
doa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:doa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AXF15_02715
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:doa03400]
    AXF15_02715
Enzymes [BR:doa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AXF15_02715
DNA repair and recombination proteins [BR:doa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AXF15_02715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 SH3_13 AAA_11 Helicase_RecD UvrD_C UvrD-helicase AAA_22 DUF2075 AAA_16 AAA_28 NACHT
Motif
Other DBs
NCBI-ProteinID: AMD92124
UniProt: A0A0X8JNT1
Position
complement(620893..622680)
Genome map
AA seq 595 aa AA seqDB search
MFATPSILPRLRASGFFSEADLYQARFAAMLVPREHQSRVAVLTALLSLAVRDGHVCLDL
DGQDIRERFAGLCPDEPEPLSAAIRLLDTDAVGAPDDIAAPMILSGRRLYFQRFFRDENL
LARQILRLASHPPRTENLPSVHRKSEAADLPDWQEVAVFAALRSRFCIISGGPGTGKTHI
VARILRHTAAIHAGERFAIALAAPTGKAAGRMNESLGRAFPGGYPPELTACLTQDAQTVH
RLLGWRPGGSFRYGPDNPLPLDMLVVDEVSMLDMEMAVLLLEALPDHASLVLLGDRGQLA
SVEAGAVLANLCPPDGMNQFSREFAAELERRTGHMVPVAECPAPLLDHMVELRRSFRFDE
RSGIGRLSALVRDGRAREVERVLKDEHPDLFLRPCPEPEALRKELSPLVRKTYLELGSMA
PDQAFSRFEGLRLLSPVRQGPRGTEALNALVRNILGVREDWYAGRPVMILENDYTAGLFN
GDTGLVLPTPEGLRVYFSGQEGFRTFSPARLPRHETCYAMTVHKSQGSEFDHAVLVLPET
PCPILSRELLYTALTRARSRFTLIGTARQAVLATQMPVRRDSGLGELLWPGNSGC
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccactccatccattctgccccggctgcgggccagcggatttttttccgaagcg
gatctgtatcaggcccgttttgccgccatgctggttccccgggaacatcaaagcagggtc
gcggtcctgacggctctgctttccctggccgtgcgcgacggccatgtctgcctggatctc
gatgggcaggatatccgggagcgcttcgccggtctgtgtccggacgaaccggagcctctg
tcggcggcaatccggctgctggacacggacgccgtgggtgcccccgatgatattgccgcg
cccatgattctaagcgggcgtcgcctctatttccagcgtttcttccgcgatgaaaatctg
ctggcccggcagattctgcgtctggccagccatccgccccggacggaaaatctcccttcc
gtccaccggaaatctgaagccgcagacctccccgactggcaggaagtggccgtctttgcc
gctctgcgcagccggttctgcatcatttccggcggtccgggaacgggaaaaacccatatc
gtggcccggattctgcgccatacggcggccatccacgccggagaacgttttgccatcgcc
ctggccgcgcccacaggcaaggccgccgggcgcatgaacgagtcgctcggccgtgctttt
cccggcggatacccgccagaactgaccgcctgcctgactcaggacgcccagaccgttcac
cggttgctgggctggcggccgggaggaagtttccggtatggcccggacaatcctctgccg
ctggacatgctggtggtggacgaggtttccatgctggatatggagatggccgtcctgctg
ctggaagccctgccggaccatgcatctctggtgcttttaggtgaccgggggcagctggcc
tcggtggaagccggggccgtgctggccaatctgtgcccgccggacggcatgaaccagttc
tcccgggagttcgcggcggagctggagcgccgcaccgggcacatggtgcccgtggccgaa
tgtccggctccgcttctggatcacatggtggaactgcgccgcagcttccgcttcgatgaa
cgcagcggtatcggccgcttgagcgctctggtccgggacgggcgcgcccgggaggtggag
cgggtgctgaaggatgaacatccggatctgttcctgcggccctgcccggagccggaagcc
ctgcgaaaggaactctctccccttgtccggaaaacctacctggagctgggctcgatggca
ccggatcaggctttcagccgcttcgagggtctgcgcctgctgtctccggtccgtcaggga
ccgcggggcaccgaggccctgaacgcgctggtcaggaacatcctcggcgtgcgggaggac
tggtacgccgggcggccggtcatgattctggaaaatgactacacggccgggcttttcaat
ggcgatacagggcttgttctgcccacgccggaaggactgcgggtgtatttttccggccag
gagggatttcggaccttttctccggcccgcctgccccggcatgagacctgttacgccatg
accgtgcataaaagtcagggctcggagttcgatcatgccgtgctggtgctgccggaaact
ccctgtcccattctgagccgcgaactcctctacacggccctgacccgggccagaagccgc
tttaccctgatcggcacggcccggcaggcggtgcttgccacacagatgcctgtccgccgc
gactccggcctgggagagctgctctggcccggaaattccggctgttaa

DBGET integrated database retrieval system