KEGG   Desulfomicrobium orale: AXF15_07575Help
Entry
AXF15_07575       CDS       T04289                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
doa  Desulfomicrobium orale
Pathway
doa00020  Citrate cycle (TCA cycle)
doa00620  Pyruvate metabolism
doa01100  Metabolic pathways
doa01120  Microbial metabolism in diverse environments
doa01200  Carbon metabolism
doa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:doa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AXF15_07575
   00620 Pyruvate metabolism
    AXF15_07575
Enzymes [BR:doa01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AXF15_07575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_C Biotin_carb_N HMGL-like Dala_Dala_lig_C ATP-grasp Biotin_lipoyl DZR ATP-grasp_3 ATPgrasp_Ter ATP-grasp_5 HypA zf-ribbon_3 zinc_ribbon_2 zinc_ribbon_15 Auto_anti-p27 NQRA NOB1_Zn_bind
Motif
Other DBs
NCBI-ProteinID: AMD92977
UniProt: A0A0X8JQG4
Position
1645761..1649450
Genome map
AA seq 1229 aa AA seqDB search
MSLVPRSFEEVAREIRGRKILVANRGIPARRIVRSIKEVFQAIPLITATDVDKTAPFTSG
AQELLHLGENPRAYLDIDKIISMAKSRGVAAIHPGWGFASEDDSFPSKCAEAGMLFIGPT
SEAMRLLGNKVQVRALAQKLGIPVVPGSEGAVSLEEARKVAREIGLPVMLKAEGGGGGRG
IYEVFSENQLADAFVKASTLAQASFGNPRLYVERLLTSVRHIEIQVITDKYGNVFAFDER
DCTVQRNHQKLVEITPSPWPGMTEELRERLKDYARQLVSAVNYYSLCTVEFLVDGQGRPY
LIEVNTRLQVEHGITECRYGIDLVEEQIAVAFGAKLRLCEENCGPQRHALQVRINCEDPQ
HGFAPNAGRITRYMSPGGPGVRVDSCVCGGYEFPPQYDSAASLLIAYGTQWDKVLGIMDR
ALGEYIVGGIKTTIPFHRQIIRHPRFRSGDYDTKFVANTPELLVYMDKESEAVRLSRLVA
EISAHGYNPYIKLGEYRTREGKRMDPFRPSLPSIEPEYYDYPYPRGDRDAILDFVRDSGT
VHFSDTTTRDITQSNSGNRFRLAEDRIIGPYLDNCGFFSLENGGGAHFHVAMLANMTYPF
SEAREWNEFAPKTLKQLLIRSTNVLGYRPVPGNVMRRTGEMICEHYDVIRCFDFLNHIEN
MRPFAEVALNSRKNIWEPAISLSWADGFTVEHYLGVVQEIVDMNARILGCSAKEAEKKFI
LGLKDMAGVCPPVFMAELVSAIRKTHPDLVLHYHRHYTDGLFVPAVAAAAKAGAHILDTA
IGASVRWYGQGEVLSTAAYIEELGLKTSLNKEMIRSAGFVLKQIMPYYDRYTAPYFQGID
YDAIEHGMPGGATSSSQEGALKQGYIHLLPYMLKFLAGIRKIVRYHDVTPGSQITWNTAF
LAITGAYKRGGRRGVRRLLAVLEQVISKPEEALSATVRTERLKIYQDANDAFRDLLLGRF
GRLPLGFPPDWVYESAFGPDYEDAIARRTEESPLALLQDVDVDKELADLEEHIGRAPTEE
ELLMYLSQPGDALNTIRFVGRYGDCNRLPLHVWFEGLKSGDEIMFKDSQGRHHVLSVKHV
SRPDDHGMSLVSYTLDSESFSIQVKVAEALGRDDAGTEMADPGNPYQVGSPSGGDLWVMH
VKPGDMVRKGEELFNISIMKQEKSVVSPVEGMVERVLKFADYQEDRKMVPVKEGELLVQL
MPAPRKCPTCQTPVTREEYRFCPACGQKV
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttgttccccgcagtttcgaggaagtggcccgggaaatccggggcaggaaaatt
cttgtggccaatcggggcattcccgccaggcgcatcgtccgttccatcaaggaggttttt
caggctatccccctgatcacggccacggacgtggacaagaccgctcctttcacctccggc
gctcaggagctgctccacctcggggaaaacccgcgggcttatctggatatcgacaagatc
atctccatggccaagtcccggggcgtggcggccatccatcccggctggggcttcgcctcc
gaggacgacagctttccgtccaaatgtgccgaagcgggcatgctcttcatcgggccgaca
tccgaggccatgcgccttctgggcaacaaggtgcaggtccgggccctggcccagaagctg
ggtatccccgtggtgccgggctccgaaggagcggtttccttggaagaggccagaaaggtg
gcccgggaaatcggcctgccggtcatgctcaaggccgaaggcggcgggggcggccgcggc
atctacgaggtattcagcgagaaccagctggccgacgcctttgtgaaggcttccaccctg
gcccaggcttccttcggtaatccgcgtctctatgtggaacgcctgctgacttcggtccgg
cacatcgaaatccaggtcatcacggacaagtacggcaatgtcttcgcctttgacgagcgg
gactgcacggtgcagcgcaaccaccagaaactggtggagataacgccttcgccgtggccg
ggcatgacggaagagctgcgcgagcgcctgaaggactacgcccggcagctggtcagcgcc
gtgaactactattccctgtgcacggtggagtttctggtggatggccagggccggccgtat
ctgatcgaggtcaacaccagattgcaggtggagcacggcatcaccgaatgccgctacggg
atcgacttggtggaagagcagatcgccgtggccttcggagcgaagctgcgtctgtgcgag
gaaaattgcggcccccagcggcatgctctgcaggtgcgcatcaactgcgaggacccgcag
cacgggttcgcgcccaacgcgggccgcatcaccaggtacatgtccccgggcggtccgggc
gtgcgcgtggactcctgtgtgtgcggcggctatgaatttccgccccagtacgattcggcg
gcttccctgctcatcgcttacggcacgcagtgggacaaggtgctcgggatcatggaccgg
gcccttggcgaatatattgtcggcggcatcaagaccaccattcccttccatcgccagatc
atccggcatccgcgttttcgctcgggcgactacgacaccaagttcgtggccaacacgccc
gagctgctggtatacatggacaaggagtccgaggccgtgcgcctgtcccggctggtggcc
gagatttccgcccacgggtacaatccctatatcaaactcggggaataccggaccagggaa
ggcaagcgcatggaccctttcaggccgtcgctgccttccatcgagccggaatattacgac
tacccctatccgcgcggcgaccgggacgccatcttggactttgtccgtgattcgggaacc
gtgcatttctccgacaccaccacccgcgacatcacgcagtccaactccggcaaccgcttc
cgactggccgaggaccggatcatcggtccctatctggacaactgcggcttcttctctctg
gaaaacggcggcggcgcgcacttccacgtggccatgctggccaatatgacctaccccttt
tccgaggcgcgggaatggaacgaattcgcgcccaagacgttgaagcagctgcttatccgc
tccaccaacgtgctgggctacaggcccgtgccggggaacgtcatgcgccgcacgggagaa
atgatctgcgagcattacgacgtcatccgctgctttgatttcctgaatcacatcgaaaac
atgcgccccttcgccgaagtggctctgaattcccgcaaaaacatctgggagccggccatc
tccctgtcctgggcagacggattcacggtggagcactatctgggcgtggtgcaggagatc
gtggacatgaatgcccggattctgggctgttccgcaaaggaagcggagaaaaaattcatc
ctcggtctgaaggacatggccggagtctgcccgccggttttcatggcggagctggtttcg
gccatccgcaagacccatcccgacctggttctgcattaccaccgccattacaccgacggc
cttttcgtgcccgccgtggccgccgcggccaaggccggagcgcatatcctcgacacggcc
atcggcgcgtccgtgcgctggtacggccagggcgaggtgctgtccacggcggcgtacatc
gaggaactgggccttaaaaccagtctcaacaaggaaatgatccgcagcgcgggcttcgtt
ctgaagcagatcatgccctattacgaccgctacacagctccgtatttccagggcatcgac
tacgacgccatcgagcacggcatgcccggcggggccacttcatcctcccaggaaggagcc
ctgaaacagggatacatccatcttctgccctacatgctcaagtttctggcgggcatccgc
aagatcgtgcgttaccacgacgtcacgccgggctcccagatcacctggaacacggctttt
ctggccatcaccggggcgtacaagcggggcggccgcaggggcgtgcgcaggcttctggcc
gtgctggaacaggtcatatcgaagcccgaagaagcgctcagcgccactgtcaggaccgag
cggctcaaaatctatcaggacgccaacgacgcgttccgcgatctgctgctgggcaggttt
ggccgcctgcccttgggttttccgccggactgggtgtacgagtcggccttcggcccggat
tatgaggacgccattgcccggcggacggaggaatcgcctctcgcgctgctgcaggacgtc
gatgtggacaaggagctggcggatctggaggaacatatcggccgggctcccacggaagag
gaactgctcatgtatctgagtcagccaggcgatgccctgaataccatccgcttcgtgggc
agatacggggactgcaaccgcctgccgctgcacgtctggttcgaggggctgaagagcggc
gacgagatcatgttcaaggacagccagggccggcatcatgtgctctctgtcaagcatgtg
tcccgtccggacgatcatggcatgagccttgtctcctatacgctcgattcggagtccttt
tccatccaggtcaaggtggccgaggccctgggccgggatgacgccggaacggaaatggcc
gatccgggaaatccctatcaggtggggtcgccttccggcggcgatctgtgggtcatgcat
gtcaagcccggggatatggtccgaaagggcgaggagctcttcaatatttccatcatgaag
caggaaaagtccgtcgtgtctccggtggagggcatggtcgagcgggtgctcaagttcgcg
gactatcaggaagacaggaagatggttccggtcaaggaaggggaactgctggtccagctc
atgcccgcgccccggaaatgtccgacctgccagactccggtcacccgggaagaatacagg
ttctgcccggcctgcggccagaaagtgtag

DBGET integrated database retrieval system