KEGG   Dokdonia sp. Dokd-P16: DCS32_07580Help
Entry
DCS32_07580       CDS       T05432                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
dod  Dokdonia sp. Dokd-P16
Pathway
dod00040  Pentose and glucuronate interconversions
dod00053  Ascorbate and aldarate metabolism
dod01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DCS32_07580
   00053 Ascorbate and aldarate metabolism
    DCS32_07580
Enzymes [BR:dod01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     DCS32_07580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Redoxin
Motif
Other DBs
NCBI-ProteinID: AWH74022
UniProt: A0A2S1QBR0
Position
1665531..1667027
Genome map
AA seq 498 aa AA seqDB search
MITGKNQIGFTQTATGNVTYKTINPLLNKENPTVFYEATQQEINTACALAHKAFHSYSQI
KGSKRASFLSAIADEVEALGASLTDMYMQESGLPEGRAQGELGRTLGQLRMFAELVSQDK
WRNSTGAGNASGLKKALIAIGPVVVFGASNFPLAFSTAGGDTASALAVGCPVIVKSHPMH
SGTGEMVATAIIKAAQKTGMPEGVFSNLNSAGIEVGEELVKNTAIKAVGFTGSHTGGRAL
YNLAAQRDTPIPVFAEMGSINPVIITQEALSNRGSQIAETYAGSITQGVGQFCTNPGLII
TVASDEAQAFVNDLANNLSKVEEGCMLHPRIQSGFTSGEKEMAKVPEVTFVMSTDSSKEN
HAAPTLAVVKGVDFINNSQLHKEVFGPFSMVVLAKDEAELLKIIENLEGQLTATLIAQDE
EVATLQGITLALQDKVGRIIYNGVPTGVAVEDGMTHGGPYPASTDSRFTAVGNHSILRWV
RPFSFQDFPSTLLPDYLK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgattacaggaaaaaatcaaataggttttacacagaccgctacgggtaacgtgacttat
aaaactataaatcctctactaaataaggaaaatccaaccgtattttacgaggctactcaa
caagaaataaatactgcttgtgcgcttgctcacaaagcctttcactcctacagtcaaata
aagggaagtaaacgcgcaagctttttaagtgctattgcagatgaggtagaggctttaggc
gctagtcttacagatatgtatatgcaagaaagtggccttccagaaggtagagcacaaggg
gaactaggtcgaacattagggcagcttagaatgtttgcagagttagtgtcacaagacaaa
tggcgcaattctacaggggcaggaaatgcaagcggacttaaaaaagcattgattgctata
gggcctgtagttgtttttggggcaagtaattttccgctggctttttctacggctggtggt
gataccgctagtgctcttgcagtcggttgtcctgttattgtaaagtcacatcctatgcat
tctggtacgggagagatggtggctactgctattattaaagctgcacaaaaaacaggaatg
ccagaaggtgttttttctaatcttaatagtgcgggtattgaagtaggagaggaactcgtg
aaaaatactgcaataaaagccgttggatttacgggtagtcatactggtggtcgtgcactg
tacaatctcgcggcacaaagagatactcctattccagtttttgcagagatgggaagtatt
aatccagtgattataacgcaggaggctttaagtaatagaggctctcaaatagccgaaaca
tatgcaggttctatcactcaaggtgtaggacagttttgtacaaatccaggacttattatt
accgttgctagtgatgaagctcaagcttttgtaaatgatctagcaaataatctgagcaag
gtagaggaaggatgcatgttgcatccacgtatacaatctggatttactagcggagagaaa
gaaatggcaaaagtacctgaagtcacttttgtgatgagtacagatagcagtaaagaaaat
catgcagctcccacactggcggttgtaaaaggtgtagattttatcaacaattctcagctg
cacaaagaagtttttggtcctttttctatggttgtgcttgcaaaagatgaagccgagtta
ttaaagattatagaaaatctagaagggcagcttacggctactcttattgctcaagatgaa
gaggttgccacattacaaggtattacactagctttacaagacaaggtaggtcgcatcatt
tacaacggagttcccacaggagttgcggtagaagatggtatgacacacggaggaccatat
ccagcaagtacagatagtcgctttacggcggtaggaaatcatagtattttgcgttgggta
aggccttttagtttccaagactttccttcgacgttgttgccagattatctaaaatag

DBGET integrated database retrieval system