KEGG   Dokdonia sp. Dokd-P16: DCS32_08295Help
Entry
DCS32_08295       CDS       T05432                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
dod  Dokdonia sp. Dokd-P16
Pathway
dod00670  One carbon pool by folate
dod01100  Metabolic pathways
dod01120  Microbial metabolism in diverse environments
dod01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dod00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DCS32_08295 (metF)
Enzymes [BR:dod01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     DCS32_08295 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AWH74159
UniProt: A0A2S1QC67
Position
1857117..1858082
Genome map
AA seq 321 aa AA seqDB search
MTKVRDHIAKAIEEKRTDFSFEILPPLKGQNINTIFDNIDPLMEFKPPFIDVTYHREEYI
YKEREDGLLEKKVVRKRPGTVGICAAIQNRYQVDAVPHVLCGGFSKEDTENFLIDMDFLG
IENVMALRGDAVKSETYYKPNKNGNIYAQDLVEQIIDLNNGTYLDEDLQNSAKTDFCIGV
AGYPEKHLEAPSLESDIHFLKKKLEAGACYVVTQMFFDNQKYFDFVDKCRAAGITKPIIP
GLKPLATKKQLNLIPQRFSVDVPDALVMEVVNAKDAAAIRQVGIEWCIQQSKELKAAGVP
VLHYYSMGKSDNIRQIAAAVF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaagagaccacatagcaaaggcaatagaagagaagagaaccgatttttca
tttgaaatattgccgcctcttaagggccaaaatatcaataccatttttgataacatagat
ccgcttatggaatttaagcctccttttatagatgtaacctaccatcgtgaggaatacatt
tataaagagcgagaagatggattgctagagaaaaaggtggtgcgaaaacgcccaggaaca
gtggggatttgtgcagcaatccaaaaccgctatcaggtagatgcagtgccgcacgtactt
tgcggaggtttttctaaagaagatactgagaattttttgatagatatggattttctaggt
attgaaaacgtgatggctttacgtggtgatgcagttaagagtgaaacttactacaagccc
aataaaaatggaaatatctatgcacaagacctcgtagagcaaattatagacttaaataat
ggcacctacctagatgaagatttgcagaatagcgccaaaacagatttttgcataggagta
gcgggttatccggaaaagcacctagaagctccaagtctagaaagtgatattcatttttta
aagaaaaagttagaagctggggcctgttatgtggtaactcaaatgttttttgataatcag
aagtactttgactttgtagataagtgtagagccgcaggtattacaaaacctattatacca
ggtctcaagccgctggcgacaaagaagcaactcaatttaattccgcaacgctttagtgta
gatgttccagatgcattagtgatggaagttgtaaacgcaaaagatgctgcagccattcgg
caagtagggatagagtggtgtatccagcaaagtaaggagctcaaagccgcaggagtcccc
gtgcttcattactattctatgggtaaaagtgataatattagacagatagcagcggctgtt
ttctaa

DBGET integrated database retrieval system