KEGG   Dokdonia sp. Dokd-P16: DCS32_08985Help
Entry
DCS32_08985       CDS       T05432                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
dod  Dokdonia sp. Dokd-P16
Pathway
dod00900  Terpenoid backbone biosynthesis
dod01110  Biosynthesis of secondary metabolites
dod01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dod00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DCS32_08985
Enzymes [BR:dod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     DCS32_08985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AWH74291
UniProt: A0A2S1QCI5
Position
complement(1996840..1998153)
Genome map
AA seq 437 aa AA seqDB search
MTKAISGFSRLSKTEKIAWLTSTYFENPTQATEVLSSYWNDDKKLQQLHDEFIENTITNY
YLPLGVAPNFVINDRIYTIPMAIEESSVVAAASKAAKFWQDRGGFKTTVLGTTKVGQVHF
TYDGDASLLTSFFESIKPQLIADTAAITKNMEKRGGGIKDITLVNKTSAVTDYYQLHCTF
ETLNAMGANFINSCLEQFATTLKTGFEEEVRFRESGANLTVIMSILSNYVPDCVVRAEVS
CPVNDLSEKNIDGAQFAKKFIQAIAIAEEEPYRAVTHNKGIMNGIDAVILATGNDFRAVE
AGVHAYAARDGQYRSLTHASVNDGIFKFWIEVPLALGTVGGLTKLHPLVKWSMELLENPS
AQELMQIVAVAGLAQNFAALKSLTTTGIQEGHMKMHLMNILNQMEATTAEKQETVTHFKT
NTVTHSAVVSFIEALRS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggcaatatcaggattttcaagactttcaaaaacggagaaaatagcgtggctc
acgtctacgtattttgaaaatccaacacaggcaactgaggtgctatcatcttactggaat
gatgataaaaaattacaacagctacacgatgagtttatagaaaacaccatcactaactac
tacttaccactaggtgttgcgccaaactttgttataaatgatcgtatttacaccatcccc
atggctattgaggaaagctctgtagttgctgccgcaagtaaagcggcaaaattctggcaa
gatagaggtggttttaaaactaccgtgctaggaactacaaaagtaggccaagtacatttt
acctatgatggtgatgcctcgcttttgacatcattttttgaatccatcaagccacagtta
attgcagataccgctgcaatcacaaaaaacatggagaaacgtggtggtggcattaaagac
atcacactcgttaacaaaacttcagctgtaacagattactaccaacttcattgcacgttt
gaaacgctaaatgcaatgggagccaattttataaatagttgtctagaacaatttgcaacg
acacttaaaacaggttttgaggaagaagtacgctttcgcgaaagcggtgcaaacctaacc
gttatcatgtctattttatcaaactatgttccagattgtgtcgtgagagcagaagtaagt
tgcccagtaaacgacctttctgaaaagaatatagatggtgcgcaatttgctaaaaaattc
atccaagcaattgctattgccgaagaagaaccttaccgcgcagtgactcacaacaaagga
ataatgaatggtattgatgccgtaattcttgccactggaaacgactttagagccgtagag
gctggtgtgcacgcgtatgccgctagagatggccaatatagaagtcttacacatgctagt
gtaaatgatggaatatttaaattttggattgaggtaccactcgcactaggaaccgtaggc
ggacttacaaaattacatccgctggtaaagtggtctatggaattgctagaaaacccatct
gcacaagagcttatgcaaattgtagctgtcgctggacttgcacagaattttgcagcctta
aaatcactcactacaacgggaattcaagaaggacacatgaaaatgcacctcatgaatatc
cttaatcaaatggaagcaactactgcagaaaaacaagaaacagtcactcattttaagacc
aatacggttacacatagcgccgttgtttcttttatagaagcactacgctcataa

DBGET integrated database retrieval system