KEGG   Dokdonia sp. Dokd-P16: DCS32_12225Help
Entry
DCS32_12225       CDS       T05432                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
dod  Dokdonia sp. Dokd-P16
Brite
KEGG Orthology (KO) [BR:dod00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dod01002]
    DCS32_12225
Enzymes [BR:dod01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     DCS32_12225
Peptidases and inhibitors [BR:dod01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   DCS32_12225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: AWH74900
UniProt: A0A2S1QEP6
Position
2732922..2734946
Genome map
AA seq 674 aa AA seqDB search
MSHKGIYALAIAAILAVGCGEDNKDDNAFAKAETTTTDFDYTVGQFADIKILRYQIPGFE
DLTLKEQKLVYYMTQAGLAGRDIMWAQNYRHNLEIRNALETIYTSDKVAKTGVEWEQFET
FMKRVWFANGIHHHYSNAKMKPDFSQDYLKQLLTESGATLEGEAFEVLFNDKDSKKVNLA
KDVDIVLESAINFYGPDVTTAEAEAFYDAIKVDENEPIEKGLNTRLVKENGKLVEQVYKS
GGLYGEAIDNIIGWLEKAQTVAENEQQGKALGLLIEYYKTGSLDTWDDYCIAWATSTEGN
IDWINGFIEVYNDPKGYKGSYETVVQIKDFDMSKKMAALSVDAQWFEDNSPLMPEHKKKE
VKGVSYKTVIVAGEAGDASPSTPIGVNLPNNNWIRQTHGSKSVSLGNIINAYNNAGGSGR
LKEFAHDAEEVELEEAYGQLGDKLHTALHEVVGHASGQINKGVGTPKETLKRYKSTIEEG
RADLFGLYYLMDPKLQEIGLVEDWEKTGMAAYDGYIRNGLMTQLIRLELGDNVEEAHMVN
RQWVSAWAFERGAKENVIEKVTRDGKTYFNITDYTKLRTIFGELLRETQRITSEGDYEAA
KALVENYGVIVDQDIHKEVLARNSQFKSAPYSGFVNPVIVPQMEGEEITGFTIEQPESFE
NQMLDYSSKYGHLD
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacaaaggaatatacgcgctagcaattgcagcgattctcgcagtaggatgtgga
gaagataataaggatgataacgctttcgcgaaagcggaaacaacaactacagattttgat
tatacagttggccagtttgccgatattaagatattacgttatcaaattccaggttttgaa
gacttaacacttaaggagcaaaagctggtgtattacatgacacaagcaggacttgcagga
cgtgatatcatgtgggcacagaattaccgtcacaatcttgagataagaaatgcactagag
acgatttatacgtctgacaaggttgcaaaaacaggagtagagtgggagcagtttgaaaca
ttcatgaagcgtgtatggtttgcaaatggtatacaccaccattacagtaacgctaagatg
aagccagatttttctcaagattacttaaaacaactacttaccgaaagcggagcaacacta
gagggagaagcttttgaagtactctttaatgataaggacagtaagaaagtaaacctagcc
aaagatgttgatatcgtacttgaaagcgcgattaacttttatggtccagacgtaacgaca
gcagaggcagaagcattttatgatgctattaaagtagatgagaatgagcctattgaaaaa
ggactcaacacacgccttgtaaaagaaaacggtaaacttgtagaacaagtttacaagagt
ggaggattatatggcgaggctatagataatataatcggttggttagaaaaagcacaaacc
gttgccgaaaatgagcagcaaggaaaagctttaggactgcttattgaatattacaagacg
ggaagccttgatacttgggatgattactgtatcgcatgggcaacctctacagaaggaaat
atagattggataaacggttttatagaagtttataatgaccctaaaggttataaaggatct
tatgagactgtagttcaaattaaagattttgacatgtcaaaaaagatggcagcactatct
gtagatgcacaatggtttgaagataactcgccattaatgcctgagcataagaagaaggaa
gtaaaaggagtttcttataaaacagtgattgtagcgggagaggctggagatgcttcacca
tctacacctattggtgtaaacttgcctaacaataactggatacgccaaacgcatggaagt
aaatcagtctctctaggtaacataatcaatgcttataataacgctggtggatctggacgt
cttaaagagtttgcacatgatgcagaggaagtcgagctagaagaagcatatggacaatta
ggagataagcttcacactgctttgcacgaagtagtaggtcatgcatctggacagattaat
aaaggagtgggaacacctaaggaaactcttaaacgttataagtctacgatagaagaaggt
cgcgcagatctttttggactatattaccttatggatccaaaacttcaagaaataggactg
gtagaagactgggaaaaaactggaatggctgcttacgatggttacattcgtaacggattg
atgacgcaacttattcgtcttgaactaggagataatgtagaagaagcacacatggtaaat
cgccagtgggtgagcgcatgggcttttgagcgtggtgcaaaagaaaatgtgattgaaaaa
gtaactcgtgatggtaagacctactttaacatcacagattacacgaagcttcgtacaatc
tttggagaattactaagagagacacagcgcattacttcagaaggagattatgaagctgca
aaagcacttgtagaaaattatggggtgattgtagatcaagatatccataaggaagtgctg
gctcgtaatagccaattcaaaagcgcaccttacagtggttttgtaaatcctgtaatcgtt
ccgcaaatggaaggtgaggagattactggctttactattgagcaaccagaaagcttcgaa
aatcaaatgcttgattattctagcaaatacggtcatttagattaa

DBGET integrated database retrieval system