KEGG   Dokdonia sp. Dokd-P16: DCS32_13780Help
Entry
DCS32_13780       CDS       T05432                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
dod  Dokdonia sp. Dokd-P16
Pathway
dod00020  Citrate cycle (TCA cycle)
dod00620  Pyruvate metabolism
dod01100  Metabolic pathways
dod01110  Biosynthesis of secondary metabolites
dod01120  Microbial metabolism in diverse environments
dod01130  Biosynthesis of antibiotics
dod01200  Carbon metabolism
Module
dod_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dod_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DCS32_13780 (mqo)
   00620 Pyruvate metabolism
    DCS32_13780 (mqo)
Enzymes [BR:dod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     DCS32_13780 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AWH75195
UniProt: A0A2S1QF18
Position
3105011..3106498
Genome map
AA seq 495 aa AA seqDB search
MTRVIPKQHYDLICVGGGIMSANLALLAKMLKPELSILILERLGDVAQESSAAWNNAGTG
HSALCELNYCPEESDGTVSIDKAIKICEQFEITKQFWAHLVEEGLIEDPQAFLKPIPHHS
WVTGEKNADYLEKRYEAFKDHFMFDTIEFTRNVSKMKEWFPLIMRGRTEDEVMAGSRIDR
GTEVNFGVLTKRLYEILETEFDTPVHFHKEVKDLDPLENGNWTAITNDLKTGTKQSIEAD
HIFIGAGGGALLLLETVEIEEKDGFGGFPVSGEWLVCKNKDIIDQHYAKVYSKAGEGAPP
MSMPHLDTRYVDGERQLMFGPFAGFSPKFLKEGSNFDLLDSVTFKNIPSMLGAFWHNLDL
TKYLIGQITMNFDDRMKDLRTFIKDAKNEDWRIEVAGQRVQTIKRDEFKGGKLEFGTQIV
SGSDGKITCLLGASPGASTAPRIMLDVLEKAFPEIMETAEGKQRLSEIVPSYKQEITKEH
FNRELKRTSALLNLD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactagagttatcccaaaacaacattacgacctcatttgtgtaggaggaggaattatg
agtgcaaatctggcattgctagccaagatgctaaaaccagaattgagcatcttaatttta
gaacgattaggagatgtagctcaagaaagttcggcggcatggaataatgctggaacgggt
cattctgctctttgcgaactcaactattgtccagaagaaagtgatgggactgtatcaatt
gataaagcaatcaaaatttgcgaacagtttgaaatcacaaaacaattctgggcgcatctt
gtagaagaaggtcttatagaggatcctcaggcatttttaaagcctatcccacatcacagt
tgggtaaccggagaaaagaacgcagattatctagagaagcgttatgaggcgtttaaagat
cactttatgtttgatactattgagtttactcgtaatgtatcaaaaatgaaggagtggttc
ccgcttatcatgagggggcgcacagaggatgaggtgatggcagggtcgcgtatagaccga
gggacagaagtaaactttggcgtacttacaaagcgattatatgagattctcgaaacagaa
tttgatactcctgtgcatttccataaagaagttaaagatctcgatccgcttgaaaatggg
aattggacagcaattacaaatgatttaaaaacaggaactaagcaatctatagaagcagat
catatctttataggtgctggtggtggtgctttactgctgctagaaactgttgagatagaa
gagaaagatggttttggtggttttcctgttagtggagaatggcttgtttgtaaaaacaaa
gatattatagatcagcattatgcaaaggtgtacagcaaggcaggcgagggcgcaccacct
atgagcatgccgcatctagatactagatatgtagatggagagcgacaattaatgtttggt
ccctttgctggttttagtcctaagtttttaaaggaaggatctaattttgacctgcttgat
agtgttacttttaaaaatataccttctatgctcggtgctttctggcacaatctagatttg
actaagtatttgataggtcagatcaccatgaattttgacgaccgcatgaaagacttacgc
acttttataaaggatgcaaagaatgaagactggcgcatagaagtagctggacagcgagta
cagactataaaacgtgatgagtttaaaggcggaaaacttgaatttggtactcaaattgta
agcggttctgatgggaaaattacttgtttacttggtgcatcgccaggagcatctacagcg
cctcgaattatgctagacgtactcgagaaggcatttccggagattatggaaactgctgag
ggcaaacaacgtttgagtgagattgtacctagctataagcaggaaataacaaaagagcat
tttaaccgtgagttaaaacgaacgtctgctttattgaacctagactaa

DBGET integrated database retrieval system