KEGG   Denitratisoma oestradiolicum: DENOEST_1223
Entry
DENOEST_1223      CDS       T06737                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
doe  Denitratisoma oestradiolicum
Pathway
doe00230  Purine metabolism
doe01100  Metabolic pathways
doe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:doe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DENOEST_1223
Enzymes [BR:doe01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     DENOEST_1223
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CAB1368388
UniProt: A0A6S6Y7H1
Position
I:1247576..1249912
AA seq 778 aa
MNKLNVVGQSVERPDAYDKVTGGKGYPVNVRLPGMLHGKMLRSPYAHARIISIDASRAER
LPGVKAVLLPRDVPQVKFCPVYFVPVQAPSMVLDFDVMNPEIVRYVGQPVAAVAATSAEI
AEAALDLIDVEYEELPAIFDPEEAMKDGAPQLHPDAPNNIAKNPSFAYGDLDQGFADADY
VFEGVYETQRVHTCYMEPRVCVVDMDRQNNVTIHVTTQHLFGTREKLAFALGLPESKVKV
VKSPYIGGGFGGKLELTAMEPVAALLSKKAGKPVRLEHTRHEDFITTTRNPIKVYLKTGV
KKDGTFTARYAKSILDCGAHATHGSEVIMVHGAFGLFFNYHAPHQKWEGYTVYTNNMIGG
GYRGYGAPQGSFAVESQIDEICTKLGLDPIEMRLKNARKQGEPHPFNPAFTLATYGLEDC
LRQGAEKINWSKARSAPRSEGSKKRGFGLAVHPVWVSGCMGFPDIYEHSGAIIKLNRDGT
ADLSSASMDIGSGQITTLCQIAAEELGLPAGAVRMSSCGDSDNLPFDAPTHASRVTYSSG
NAVKAAAAAAKKRLFDVAATMMEVSPDDLESCNGRVNVKGSPDKSISIAEIAQRAESPFV
QMTAEGPKPTTIEEKGTIIGVASLAPKSNPTPCAAQFVEVEVDTETGEVKVLHAVYAHDI
GRAINPKAAEGQVEGGFQQGMGYALMEQIQFDPETGACLTSDFLDYKMPTAMEMPRKMDS
IFIETDEPTGPFGAKSLGECCVITPAPAIANAIYDAIGVRFTQLPITPEKILAGLGKL
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgaacaagttgaatgtcgtcgggcagagcgttgagcggcccgatgcctatgacaaggtg
accggcggcaaaggctacccggtcaatgtaaggctgcctgggatgcttcacgggaagatg
ctgcgcagcccctatgcccatgcacgaatcatcagcattgacgcttcccgggccgagcgg
ctgccgggcgtcaaggcggtgctgctgcccagggacgtgccccaggtgaagttctgtccc
gtgtatttcgttccggtccaggcaccgagcatggttctggacttcgatgtcatgaatccc
gaaatcgtgcgttacgtcggtcagcccgtggcggcagtggccgcaacctcggcggagatc
gccgaggcggctctggacctgatcgatgtggagtacgaggaactgcccgcgatttttgat
cccgaggaggccatgaaggatggagcgcctcaactgcaccccgatgcgccgaacaatatc
gccaagaatccctccttcgcctacggcgatctggaccagggtttcgccgatgcggactac
gtgttcgagggtgtctacgagacccagcgcgttcatacctgctacatggagccccgggtc
tgcgtggtcgatatggaccgccagaacaacgtcaccatccatgtgaccacccagcacctg
ttcggtacccgggagaagctggcctttgccctgggtttgcccgagagcaaggtcaaggtg
gtcaagtctccctacatcggcggcggtttcggcggcaagctggagttgaccgccatggag
ccggtggcggccctgttgagcaagaaggcgggcaagccggtgcgcctggagcacacccgc
catgaggacttcatcaccaccacccgcaacccgatcaaggtctatctcaagaccggcgtc
aagaaggacggcaccttcaccgcccgctacgccaaaagcatcctggactgcggcgcccat
gccacccacggttccgaagtgatcatggtgcacggcgccttcggcctgttcttcaactat
cacgcgccccatcagaagtgggaaggctacacggtctacaccaacaacatgattggtggc
ggctatcgcggctatggcgcgccccagggcagttttgcggtggagtcccagatcgacgag
atctgtaccaagctgggtctggaccccatcgagatgcgtctcaagaatgcccgcaagcag
ggcgagccccatcccttcaacccggccttcaccctcgccacctacggcctggaagactgc
ctgcgccagggtgccgagaaaatcaactggagcaaggccaggtccgccccccgcagcgag
gggagcaagaagcgcggcttcggcctggcggtgcatccggtctgggtcagtggatgcatg
ggtttcccggacatctacgagcattccggtgccatcatcaaattgaatagggacggcacc
gccgacctgtcctcggcgtcgatggatatcggttccggccagatcaccaccctgtgccag
atcgcggccgaggaactgggcctgcctgccggcgcggtgcgcatgagcagttgcggcgat
agcgataacctgcccttcgatgcccccacccatgccagtcgggtgacctactcctccggc
aacgccgtcaaggcggcggcagcggcggccaagaagcgtctgttcgatgtggcggcgacg
atgatggaagtcagcccggacgatctcgagtcctgcaacggccgggtcaatgtcaagggt
tcgccggacaagtccatctccatcgccgagattgcccagcgcgccgagtcgcccttcgtg
cagatgaccgccgagggccccaagcccaccaccattgaagagaagggcaccatcatcggg
gtggccagccttgcccccaagtcgaatccgacgccttgcgccgcccagttcgtcgaggtg
gaggtggatacggagaccggcgaggtcaaggtcctgcacgcggtgtacgcccacgacatc
ggccgcgccatcaatcccaaggccgccgagggccaggtggaaggcggcttccagcagggc
atgggctatgcgctgatggagcagatccagttcgatccggagaccggcgcctgtctgacc
tcggacttcctcgactacaagatgcccacggccatggaaatgccgcgcaagatggacagc
atcttcatcgaaaccgatgagcccaccgggcccttcggcgccaagagcctgggggagtgc
tgcgtcatcacaccggcgccggccatcgccaacgccatctacgacgccatcggggtgcgc
ttcacgcaactgccgatcactccggagaagattctggccggtctcggcaagctctga

DBGET integrated database retrieval system