KEGG   Dokdonia sp. MED134: MED134_01775Help
Entry
MED134_01775      CDS       T03275                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dok  Dokdonia sp. MED134
Pathway
dok00620  Pyruvate metabolism
dok00630  Glyoxylate and dicarboxylate metabolism
dok01100  Metabolic pathways
dok01110  Biosynthesis of secondary metabolites
dok01120  Microbial metabolism in diverse environments
dok01200  Carbon metabolism
Module
dok_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MED134_01775 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MED134_01775 (aceB)
Enzymes [BR:dok01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MED134_01775 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: EAQ38684
Position
complement(1247596..1249191)
Genome map
AA seq 531 aa AA seqDB search
MAPEINQYAISFNRNVKSYYSEILTDEALDFIKALHERFNSRRLELLQAREQQQLLFDQG
QKPLFPTETKDIREGEWVAGEIPHDLQDRRVEITGPTDRKMVINALNSGARTFMADLEDS
TAPSWQNVMEGQINLRDAVNKTITYHHPTKDKKYTLNDEVATLLVRPRGWHLNEKHLLID
NVEVSGSLVDFGLYFFTNVSQLLKNNTAPYFYLAKLEHYLEARLWNDVFEFAQEYLQLPL
GTIKCTVLIETITASHQLDEIIYELKDHIVGLNCGRWDYIFSYIKKFRNDPDFLVPNRDQ
VGMTAPFMDAYSKLVIQRCHKRKILAIGGMAAQVPIKNNPQANKAALEKVRKDKEREVKN
GHDGTWVAHPALVQVAIDEFNAYMPAPNQVEVTRDDVTVTANDLIAIPEGTVTEDGVRKN
INVGILYLNAWLSGQGAVALYHLMEDAATAEISRTQIWHWLKNKAVLEDGNVLTKDLYTM
LFDEEVEKIITEVGADKIEATQFENAFNLFNDLVLSEDFEEFLTTPAYTYL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagaaataaaccagtatgcaataagttttaaccgtaatgttaaaagctattac
tcagagatattaacagatgaggctttagactttattaaagcccttcacgaacggtttaat
tccagacggttagaattactacaagcaagagagcaacagcagctattgtttgatcaaggt
cagaaacctttatttccaacggagacaaaagatattagagagggtgagtgggttgcagga
gagattcctcacgacttgcaagatagaagagtggagattacggggcctacagatcgtaaa
atggttataaatgcgctcaactctggagcaagaacttttatggcagatctagaagatagt
accgcacctagctggcagaatgtgatggaaggtcagattaatcttcgtgatgctgtaaat
aaaacaataacctatcatcaccctactaaagataaaaaatatacacttaacgatgaggtt
gccaccttactagtaagacctagaggatggcatctcaatgagaagcatttacttatagat
aatgtagaagtatcgggttcactggtagattttggattatacttttttacaaacgtttcc
caacttttaaaaaataacacagcgccttatttctatctggcaaagttggagcactatcta
gaggcaagactctggaatgatgtatttgagtttgcacaagagtacctgcagttgccttta
ggtactataaaatgtacagtacttatagaaactattacagcaagtcaccagctagatgaa
attatttatgaattaaaagaccacatcgtaggtcttaactgtgggcgttgggattatata
ttttcatacatcaagaagtttagaaatgatccagacttcttagtgcctaatcgtgaccag
gtagggatgaccgcaccatttatggatgcctattcaaaacttgttatacaacgctgtcac
aaaaggaaaatcttagccataggcggtatggcagcacaagtgcctataaaaaataaccct
caggcaaataaggcagctttagaaaaagtaagaaaggacaaagagcgtgaggtaaaaaat
ggacacgatggtacctgggtagcacatccagcactagtgcaagttgcgatagatgagttt
aatgcatatatgccagcacctaaccaggtggaagtcactagagatgatgtaaccgtcacg
gcaaatgatcttatagctattccagaaggtacggttacagaggacggtgttcgtaaaaat
atcaacgtaggtattctgtatctcaatgcctggctcagtggccagggagcagtggcactc
tatcaccttatggaagatgctgctacagccgaaatctcaagaactcaaatctggcactgg
cttaaaaataaagccgtcttagaggatggaaatgtgcttactaaagatctgtacacaatg
ctttttgatgaagaggtggaaaaaataataacagaggtgggggcagataagatagaggca
acccaatttgaaaatgcttttaatctctttaatgacctcgtcttatcagaagattttgaa
gaatttttaaccacaccagcttacacatatttataa

DBGET integrated database retrieval system