KEGG   Dokdonia sp. MED134: MED134_02210Help
Entry
MED134_02210      CDS       T03275                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dok  Dokdonia sp. MED134
Pathway
dok00020  Citrate cycle (TCA cycle)
dok00310  Lysine degradation
dok00380  Tryptophan metabolism
dok01100  Metabolic pathways
dok01110  Biosynthesis of secondary metabolites
dok01120  Microbial metabolism in diverse environments
dok01130  Biosynthesis of antibiotics
dok01200  Carbon metabolism
Module
dok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dok_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MED134_02210
  09105 Amino acid metabolism
   00310 Lysine degradation
    MED134_02210
   00380 Tryptophan metabolism
    MED134_02210
Enzymes [BR:dok01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MED134_02210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: EAQ38771
Position
complement(1156452..1157771)
Genome map
AA seq 439 aa AA seqDB search
MARFELKLPKMGESVAEATLTSWLKEVGDVIEADEPVLEIATDKVDSEVPSEVDGVLVEK
LFDVDAVIEVGQTIAIIETDGEGGDTATTETTVQEVVEEAPPEAAAVAQTVTAAQDAVAA
PVSSGDRFYSPLVRNMAKQEGISQSELDAIQGSGKDGRVTKDDMVSYLANRGTQKAAPAT
QGVKAQPAQKSAPAKKAAPVSVNGEDEVIEMTRMGKLISHHMVASVQTSAHVQSFIEADV
TNIWNWRKKNKDAFAKKEGENLTFTPIFMEAVAKAIRDYPLINIAVDGDRIIKRKNINLG
MAAALPDGNLIVPVIKNADQLNLVGMAKSVNDLAGRARDGKLKPDDTAGGTYTVTNVGTF
GSIMGTPIINQPQVAILALGAIRKVPAVIETPDGDFIGIRMKMFLSHSYDHRVVNGALGG
QFVKRVAEYLENFDVNREI
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttgaattaaagctaccaaaaatgggagagagtgttgcagaagcaacgctt
acatcgtggttaaaagaagtaggagatgtcatagaggcagacgagcctgtacttgagatc
gcaacagataaggtagatagtgaagtgcctagtgaagtagacggagtactagtcgaaaaa
ctttttgatgtagatgctgtgatagaagtgggacaaaccatagctattatagaaacagat
ggtgaaggtggtgatacagcaactacagagactactgtacaagaggttgtagaagaagct
cctccagaggcagctgccgttgctcaaacggtaacagcagcccaagatgcggtagcagca
ccagtaagttctggagatagattttactcaccgcttgtgcgtaatatggcaaagcaagaa
ggaatctctcagtctgaacttgatgcaatacaaggatctggtaaggacggtcgtgtgact
aaggatgatatggtgtcataccttgcaaaccgcggtactcaaaaagccgctccagcaaca
caaggtgttaaggcgcagccagcacaaaaaagcgcaccagccaaaaaagccgctccagta
agcgtaaatggtgaagatgaggtgatagagatgactcgtatgggtaaacttatatcgcac
catatggtggcatctgtgcagaccagtgctcacgtacaatcatttattgaggcggacgta
actaatatctggaactggcgtaagaagaataaagatgcatttgcaaagaaggaaggtgag
aaccttacatttactcctatatttatggaggcagtggcaaaagcaatacgtgattaccca
ctcataaacatcgcagtagatggtgatcgtattataaaacgtaaaaacataaacctgggt
atggcggcagctttaccagatggtaaccttattgtaccggttataaaaaatgcagaccag
cttaaccttgtaggaatggcaaaatctgtaaatgatcttgctggtagagctcgtgacggt
aagttaaaaccagacgataccgctggagggacatatactgtgacaaatgtaggtaccttt
gggtctataatgggaacacctattataaaccagccacaagttgctatacttgctcttgga
gctatacgcaaagtacctgcagtgatagaaactccagatggggactttataggtatacgt
atgaagatgttcttatctcactcttatgatcaccgcgtggtaaatggagcgctaggaggt
cagtttgtaaagagagtagcagagtacttagaaaactttgatgtaaatagagagatataa

DBGET integrated database retrieval system