KEGG   Dokdonia sp. MED134: MED134_10331Help
Entry
MED134_10331      CDS       T03275                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
dok  Dokdonia sp. MED134
Pathway
dok00010  Glycolysis / Gluconeogenesis
dok00020  Citrate cycle (TCA cycle)
dok00620  Pyruvate metabolism
dok01100  Metabolic pathways
dok01110  Biosynthesis of secondary metabolites
dok01120  Microbial metabolism in diverse environments
dok01130  Biosynthesis of antibiotics
dok01200  Carbon metabolism
Module
dok_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MED134_10331 (pckA)
   00020 Citrate cycle (TCA cycle)
    MED134_10331 (pckA)
   00620 Pyruvate metabolism
    MED134_10331 (pckA)
Enzymes [BR:dok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     MED134_10331 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP PEPCK_GTP
Motif
Other DBs
NCBI-ProteinID: EAQ39883
Position
2302331..2303944
Genome map
AA seq 537 aa AA seqDB search
MVADSLASKTLSLEKIGIKNAKINYQLSPEKLHQIAVENDMGKTASSGALAVNTGKFTGR
SPMDRFIVRDAKTEGKVWWGDINLPFEEEAFAKLKTKVANYLSEKEIYVRDSYACADKDY
KLNIRVVNEYPWSNMFAYNMFLRPTEEELKGFDPEWTILNAPGFLADPAVDGTRQSNFAI
LSFTEKTIIIGGTGYTGEIKKGIFSALNFILPVEKETLPMHCSANVGDNGETAIFFGLSG
TGKTTLSADPERKLIGDDEHGWTKDNTIFNFEGGCYAKVINLSAENEPDIYNAIKPGAIL
ENVILDEQGNVAFEDTSITQNTRVSYPIDHIENIQVPSLGKNPKNIFFLTADAFGVLPPI
SKLTPGQAAYHFISGYTAKVAGTEAGVNEPVPSFSACFGAPFMPLHPTKYAEMLSKKMTE
AGVNVWLINTGWTGGPYGVGSRMKLKYTRAMIKAAMEGKLPQETTHDDYHIHSVFGLAQP
RTCPGVPTEVLSPRATWNNDKGYYETANKLARSFKENFKQFEAYASEEIMNGQPPLG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcagatagcttagcatcgaagacactctcattagaaaaaattggcataaaaaat
gccaaaatcaactaccaactttctcccgaaaaactacatcaaattgctgtagaaaatgat
atgggtaaaaccgcatcatctggcgctctcgctgtaaacacaggtaagtttacaggtaga
tctcctatggatcgttttatcgtaagggacgcaaaaacagaaggtaaagtctggtgggga
gatataaacctcccctttgaagaagaggcgtttgcaaaacttaaaacaaaagttgcaaac
tatctctcagaaaaagaaatctacgtgcgtgatagttatgcgtgtgcagataaagattac
aaactcaacatacgcgttgtaaacgagtacccttggtctaatatgtttgcatataatatg
tttcttagacctacagaagaggagcttaaaggatttgacccagagtggacgattttaaac
gcaccgggctttctagcagatccagctgtagatggtacacgccagagcaactttgcgata
ttatcttttacagaaaaaaccatcattatagggggtacaggttacacaggtgagattaag
aaaggaatcttctctgcgcttaactttatacttcctgtagagaaagagacattacctatg
cactgtagtgcaaacgtaggtgataacggtgagaccgctatcttttttggactttctgga
acaggtaaaaccacactctctgcagatcctgagcgcaagcttataggtgatgatgagcac
gggtggactaaagataacaccatctttaactttgagggtggctgttatgcaaaagtgatt
aacctctctgccgaaaatgaaccagatatctacaatgctataaagccaggagccattcta
gagaatgtcatactagatgagcaaggtaatgtagcttttgaagatacatctatcacacaa
aacacacgtgtaagttaccctatagatcacattgagaacatacaggtaccatcactaggt
aaaaacccaaaaaacatcttcttccttacggcagatgcttttggagtactacctcctatc
tctaagcttacaccaggtcaagccgcataccactttataagtgggtatactgcaaaggtt
gctggtacagaagcaggagtaaacgagcctgtaccatcattttcagcgtgttttggagcg
ccatttatgccgcttcaccctacaaaatatgcagagatgcttagtaagaaaatgacagaa
gctggagtaaatgtatggcttatcaatacaggatggaccggcggaccttacggagtagga
tcacgtatgaagttaaagtacacgcgcgcaatgattaaagctgcgatggaagggaagtta
ccacaagaaaccacgcacgatgactatcacatacactcagtttttggactagcacaacca
cgtacgtgtccaggagtgcctacagaagtattgagcccacgcgcaacgtggaataatgac
aaaggttattatgaaacggcaaacaagcttgcaagatcttttaaagaaaacttcaagcag
tttgaagcatatgcaagtgaagagattatgaatggacagccaccattaggctag

DBGET integrated database retrieval system