KEGG   Dokdonia sp. MED134: MED134_11651Help
Entry
MED134_11651      CDS       T03275                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
dok  Dokdonia sp. MED134
Pathway
dok00360  Phenylalanine metabolism
dok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dok00790  Folate biosynthesis
dok01100  Metabolic pathways
dok01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MED134_11651 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MED134_11651 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MED134_11651 (phhA)
Enzymes [BR:dok01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     MED134_11651 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H Endotoxin_C2 MIX
Motif
Other DBs
NCBI-ProteinID: EAQ38549
Position
complement(2606853..2608580)
Genome map
AA seq 575 aa AA seqDB search
MHTNVESNPLLDRLPPHLKQYIKAQDYEQYTPINQAVWRYVMRKNVDYLSKVAHESYIMG
LEKTGISIDNIPSMYGMNRILKEIGWAAVAVDGFIPPNAFMEFQAYKVLVIASDIRQLEN
IEYTPAPDIIHEGAGHAPIIASPDYAEYLRRFGEIGAKAISSAHDMEMYEAVRTLSILKE
ADGITQEAIDAAERSVEQLQNKEVQPSEIALIRNLHWWTVEYGMVGTVENPKIYGAGLLS
SIGESTWCMTDEVKKIPYSIDAAYQEFDITKPQPQLFVTPDFAYLMQVLEEFAGTMAVRK
GGWRGLKKLIESKQIGTLELNTGLQVSGIFTEMIQNDDNEVVYFATQGETALSYREKELI
GHGVNRYKNGFSSPLGKLKGINLSIENMGPRDLKAYDFYDGKPISFEYESGITVSGLNVT
GMRNLGGQLMLIQFTDCTVTYGDKILHDPTMGDFDLVIGSQIVSAFAGAADFLSFDLITH
VAETNTVKPTLSEKEDTLNRLYQQVRLQRESNQIDKEALLEVFTSLQKDYPQDWLCALEI
YELTKDTAVLTHLKEVQKHKEKVAHLITNGLELIQ
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaacgtcgagagtaatccgctattagacaggcttccgccgcacttaaaacaa
tatatcaaagcacaagattatgagcagtacacgcccataaatcaagccgtatggcgatat
gtgatgcgtaaaaacgtagactatctaagtaaagtagctcacgagagctatataatggga
ttagaaaaaaccggtatctctattgataacatcccttctatgtacgggatgaatcgtatc
cttaaagaaataggatgggcagccgtagccgtagatggttttataccacctaatgctttt
atggagtttcaagcatacaaagtgcttgtcattgccagtgatatacgccagctagaaaac
atagagtacacccctgcgccagacatcatacacgagggagccgggcacgcgcctattatt
gcaagtccagactatgcagagtacttaagaagatttggagagataggtgcaaaagccatc
tctagtgcccacgatatggaaatgtacgaagctgtacgtacactatctattcttaaagag
gcagatggcatcactcaagaagcgatagatgccgccgaaagaagtgtagaacagttacaa
aacaaagaggtacagccttctgaaattgcacttatacgcaacctacactggtggacggta
gagtatggaatggtaggcactgtagaaaacccaaaaatttacggagcaggactactctct
tctataggtgagagcacctggtgtatgacagacgaggtaaagaaaataccttactcgata
gatgctgcataccaagaatttgacattacaaaaccgcaacctcaactctttgtcacacca
gactttgcatacctaatgcaagtcttagaagaatttgcaggtacaatggcagtacgtaaa
ggtggctggcgcggactaaaaaaactcatagaatcaaagcaaataggtacactagaactc
aacacaggtttgcaagtaagtggcatttttacagagatgattcaaaatgacgataacgag
gtggtttactttgctactcaaggtgaaacagcactttcttatagagagaaagaacttata
ggtcacggagtaaaccgttacaaaaacggttttagctctcctctaggtaagcttaagggc
ataaatctctctatagaaaatatgggaccaagagacttaaaagcttatgacttttatgat
ggtaagcctatctcttttgaatatgaaagtggcatcaccgtaagtggattaaatgttacc
gggatgcgtaacctaggtgggcagttaatgcttatacagtttacagattgtacggtaact
tatggtgacaaaattctacacgacccaactatgggagactttgacctagtgataggttca
caaattgtctctgcctttgccggagcggcagacttcttatcttttgatctcattacacac
gtcgccgagactaatacggtaaaacctacgctctcagaaaaagaagacacgcttaacagg
ctctaccagcaagtacgattacaaagagaaagcaatcaaatagacaaagaagcacttctt
gaggtatttacaagcttacaaaaagactatcctcaagactggttatgtgccttagaaatt
tatgaactcacaaaagacaccgccgtactcacacatcttaaagaggtgcaaaaacataaa
gagaaggtagcacacctcatcacaaacggcctagaattaatacagtaa

DBGET integrated database retrieval system