KEGG   Desulfococcus oleovorans: Dole_2191
Entry
Dole_2191         CDS       T00610                                 

Name
(GenBank) Formate C-acetyltransferase
Organism
dol  Desulfococcus oleovorans
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 SCP2
Other DBs
NCBI-ProteinID: ABW67995
UniProt: A8ZUG3
Position
2662702..2665665
AA seq 987 aa
MNANRKGMTNMLANLFFRFFAANFNLRPALNRYLSCDDGPINFTFGIRTESGSVEQAVQF
ENGRVRVLKKMPEKPDAQLVFVDEAAVKEAATQPPNKLMLALMENRMVTRGNLGYLQLMN
FYLSLLLKKVQVGKLQKEAKREKRDYDPAEASQKSINKKNKDRLSATATDPGVRFLADPY
LADYSLDDFPRLKTFLDIHLKTRPALCHERPEILTRWYRENGFETDKNGEPWVAEIRQAH
ALKYLMENRKPLIRENDLVAGTTTAQEIGVVLYPDAHGTMIWGELLTAPHRPLNPYDVSP
NTIDVLHNSVFPFWLNRNFREWVRDNKGYPDCQKLDERFAACFLWKTVALSHTILDYPTL
LSLGTKGIMAQIDAEIGRTSEADAEKHTTLRAMKLTLEGINAYAKNLAAEAHRLAGMEKD
PARKKELVRLADICRKVPENPAATLDEAINAIWIVWVGVHMENTNAGFSLGRMDQWLQPY
FEADMAALKNENEQKDYIRRAIELVGCFYMRCTDHLPLIPDIGNYLFGGSSSDQAITLGG
VTPDGEDAVNDMTYIFLKVTEMLSIRDPNVNARYNREKNSDAYLARLCEVNLNTAATPSI
HNDEAVMASLAEFNYPAEHLRDWAATGCVEPTLSGRHIGHTNCMMFNMVAALEMALNNGR
HPLMRWDLGPKTGDVTTGHFKDFESFFEAFATQLGFLADQTCEYNNLLGQAHQTIRPTPY
ISALIQGPKEKGRDVTKGGALYNSSGVACIGLADITDSMMVIKKLVFDGKQVSFGDLHRA
LAANFENEPALLAIIKNKIPLFGSGDKEALAMANRIIRLAHDIFGAHTNYRGGPYTAGFW
SMSNHVAFGTLTGALPSGRLAGKAFTPGLTPEPHSSPSILDNLRDVAGLDPTAMNNNIAF
NVKVVPAPGESHAQTVNTLCSYTKAYTGLGGMQMQLNVVSSDTLRDAMEHPENYQNLLVR
ISGYNAYFVSLNREMQIELIERAEFGM
NT seq 2964 nt   +upstreamnt  +downstreamnt
atgaatgcaaaccgtaaaggcatgaccaatatgctggccaacctgtttttccggtttttt
gccgccaacttcaaccttcggcccgcgttgaaccgttacctttcgtgcgatgacgggccc
atcaattttaccttcggcattcgcaccgaaagcggcagcgtggaacaggctgttcagttt
gaaaacggccgagtccgtgtactgaaaaaaatgccggaaaaacccgacgctcaactggtg
tttgtggacgaagccgcggtaaaggaggcggccacccagccccccaacaagctgatgctg
gccctgatggaaaaccgcatggtcacccggggcaacctgggctacctccagctgatgaac
ttttacctgtcgctgctgttaaaaaaggtacaggtgggaaagctgcaaaaagaggccaaa
cgggaaaagcgggattacgatccagccgaagcgtctcagaaaagcattaacaaaaaaaac
aaagaccggctgtcggccacggccacggaccccggggtccggtttcttgccgacccctac
ctggcggattacagcctggacgactttccccggctcaaaacctttctggatattcattta
aagacccgacccgccctctgccacgagcggcccgaaatcctgacccggtggtacagggaa
aatggttttgaaaccgacaaaaacggcgagccctgggtggccgagattcgccaggcccat
gccttaaaatacctgatggaaaaccgcaaacccctcattcgggaaaacgacctggtggct
ggcaccaccaccgcccaagagatcggcgtggtgctctacccggacgcccacggcaccatg
atctggggtgaactgcttaccgccccccacaggcccttaaacccctacgacgtttccccg
aacaccattgacgtgctgcacaactccgtgtttcccttctggctgaaccgcaatttccgc
gaatgggtgcgggacaacaaaggctatcctgactgtcagaaactcgacgagcggtttgcc
gcctgctttttgtggaaaaccgtggccctttcccacaccattcttgattacccgaccctg
ctctctctgggcacaaaaggcatcatggcccaaatcgacgccgagattggccgcaccagc
gaggcggacgcggaaaagcacaccaccctgcgggccatgaagctgaccctggagggcatc
aacgcctacgcgaaaaacctggccgctgaagcccaccggctggcaggcatggaaaaagac
ccggcccgcaaaaaagagctggtccggctggccgacatctgccgaaaggtgccggaaaac
ccggccgccaccctggatgaagcgatcaacgccatctggatcgtctgggtgggggttcac
atggaaaacaccaacgccggtttttccctgggccgcatggaccagtggctgcaaccctat
tttgaggcggacatggcagccctgaaaaacgaaaacgaacagaaggactatatccgccgc
gccatcgagcttgtcgggtgcttctacatgcgatgcaccgaccacctgcccctgattccg
gacatcggcaactacctgttcggcggcagctcatcggaccaggccatcaccctgggcggg
gtgaccccggacggcgaggacgcggtcaacgacatgacctacatctttttaaaggtcacg
gagatgctctccattcgggaccccaacgtcaatgcccggtacaaccgcgaaaaaaacagc
gacgcttatcttgcgcggctctgcgaggtgaacctgaacaccgcggccaccccctccatt
cacaatgacgaggcggtcatggcctcgctggccgaattcaactacccggccgagcacctg
cgggactgggccgccaccgggtgcgtggagcccaccctttccggccgtcacatcggccac
accaactgcatgatgttcaacatggtggcggcccttgaaatggccttgaacaacgggcgc
caccccctgatgcgctgggacctgggccccaaaacaggggacgtgaccaccggccatttc
aaggattttgaatcgtttttcgaggcctttgcaacccagcttggatttctggccgaccag
acctgcgagtacaacaacctgctgggccaggcccaccagacaatccggcccacgccatac
atctcggccctgatccagggcccgaaagaaaaaggcagggatgtcaccaaaggcggggcc
ctttacaactcgtcaggcgtggcctgcatcggtcttgccgacatcaccgactccatgatg
gtgatcaagaaactggtgttcgacggcaagcaggtctcctttggcgatcttcaccgggcc
ctggccgccaattttgaaaacgaaccggccctgctggcgatcatcaaaaacaaaattccc
ctgttcgggtccggcgacaaagaggccctggccatggccaaccgcatcatccggctggcc
cacgacattttcggggcccacaccaactaccggggcggcccctataccgcggggttctgg
tccatgtccaaccacgtggccttcggcaccctgaccggagcactgccgtcgggacgactg
gccggcaaggcctttacaccgggcctgacccctgaaccccattcttcccccagtatttta
gacaacctgcgcgacgtggccggcctggaccccaccgccatgaacaacaacatcgccttt
aacgtcaaggtggtgccggcgccgggcgagtcccatgcccagaccgtcaacaccctctgc
tcctataccaaggcctataccggcctgggcggcatgcagatgcaactcaacgtggtgtcg
tcggacacgctgcgcgacgccatggaacacccggaaaactaccagaacctgctggtgcgc
atatcgggatacaacgcctattttgtctcgctgaaccgggagatgcagatagagctgatt
gaacgggctgaattcggcatgtga

DBGET integrated database retrieval system