KEGG   Desulfococcus oleovorans: Dole_0295Help
Entry
Dole_0295         CDS       T00610                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00520  Amino sugar and nucleotide sugar metabolism
dol01100  Metabolic pathways
dol01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dol00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dole_0295
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Dole_0295
Enzymes [BR:dol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dole_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 HHV-1_VABD ApbA
Motif
Other DBs
NCBI-ProteinID: ABW66105
UniProt: A8ZS87
Position
complement(339512..340543)
Genome map
AA seq 343 aa AA seqDB search
MAATDKRPFSLSGFSDDMLAGQRLVAGFEGTTLNDDLKYLIDTLKVGGIILFAVNLEHPD
QIRDLCASAQAHAAACRLPPLFVAIDQEGGQVARLKPPFTRFEGNPSITTDDQARHFARI
TASELAGIGVNMNMAPVLDVADGVTDSVMAGRAFAGGPREVARLGGVVIEEMQKNGIMAV
GKHFPGIGRTTADSHIDQPWLAADPAEMETTDLVPFKTAIERDVAGIMLSHIRYTALDPD
LPASMSTPIAKTLLREKLGYEGLVMTDDLDMGAIRNHHVMDQVVRCADRAGIDMVLVCHK
GPDRKKAVESFRELLETSDTHRKQALCSVERILRAKARYLCRI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaccgacaaacgccctttttccctctccggcttttccgatgacatgctggct
ggccagcggcttgtggccggatttgagggaacaaccctcaacgacgacctcaaatacctg
atcgacaccctcaaggtggggggtattattctgtttgccgtgaacctggagcaccccgat
cagattcgcgacctgtgcgcttcggcccaggcccatgccgcggcctgccgcctgccgccc
ctgtttgtggccatcgaccaggaagggggacaagtggcccggctcaaaccgccctttacc
cggtttgagggcaacccttcaatcaccacggatgaccaggcccggcacttcgcccgaatc
accgcgtccgagctggccggcatcggggtgaatatgaacatggcgccggtgctggacgtg
gccgacggggttaccgacagcgtcatggccggccgggcctttgccggcggcccccgggaa
gtggcccggctgggcggcgtggtcattgaagagatgcagaaaaacggcataatggccgtg
ggcaagcactttcccggcatcggccgcaccacggccgactcccacatcgaccagccctgg
ctggcggccgatcccgcagaaatggaaaccaccgacctggtgccgtttaagacggccatc
gaacgggacgtggccggcatcatgctttcccatatccgctacaccgccctggatccggac
ctgccggccagcatgtcgacacctattgcaaaaaccctgctgcgggaaaaattgggatat
gaaggcctggtgatgaccgacgatctggacatgggcgccattcgcaaccaccatgttatg
gatcaggtggtgcgatgcgcggaccgggccggcatcgacatggtgctggtctgccacaag
gggccggacagaaaaaaggcggttgagtccttcagggaactgctggaaacatcggacacg
cacagaaaacaggccctgtgctcagtggagcggattctgcgggccaaggcccgttatctt
tgccgcatttga

DBGET integrated database retrieval system