KEGG   Desulfococcus oleovorans: Dole_1132Help
Entry
Dole_1132         CDS       T00610                                 

Definition
(GenBank) aminotransferase class-III
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
dol  Desulfococcus oleovorans
Pathway
dol00860  Porphyrin and chlorophyll metabolism
dol01100  Metabolic pathways
dol01110  Biosynthesis of secondary metabolites
dol01120  Microbial metabolism in diverse environments
Module
dol_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dole_1132
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dol01007]
    Dole_1132
Enzymes [BR:dol01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Dole_1132
Amino acid related enzymes [BR:dol01007]
 Aminotransferase (transaminase)
  Class III
   Dole_1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABW66939
UniProt: A8ZXI1
Position
complement(1344365..1345615)
Genome map
AA seq 416 aa AA seqDB search
MTTPYTYENSRRLFEKAAGVIPCGIYGHFSPAPLVPPENYPFFAQKASGARFTDIDGNEF
IDYMCAYGPMVLGYNCEPVDRAALAQLEKGNCLSCPGPVMVELAEKLVNTVAQMDWAFFA
KNGNDVTSYALMVARHATGRKKIVAIRGGYHGTAPWAQTFGHHGVTEEDAAHMVRIPWND
AAAFEAVLEQYPGQIAGFIATPYHHPVFADNEMPAQGYWQKIEALCRKHGVVLIVDDIRC
GFRLDLRGSHVYFGFTPDLVCFCKAIGNGYPISALMGTDALKSAAAKVFYTGSYWFSAVP
MAAAIATLDEMARINAAAAMLAYGEKLRDGLIETARRHGYDLKVSGHPAMPYLRITDDPS
LMLHQRWCGECTRRGAFFTSHHNWFVSAAHTEEDLARTLEIADEAFAVIGDNPQKK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacgactccctatacctatgaaaactccagacgcctttttgaaaaagcggccggcgtc
atcccctgcggcatttacggtcacttcagcccggcccccctggtgccgccggagaattac
ccctttttcgcgcaaaaggcctccggcgcccgctttaccgacatcgacggcaatgagttt
atcgactacatgtgcgcctacggccccatggtgctgggctacaactgcgagcccgtggat
cgggccgccctggcccagttggaaaagggcaactgcctctcctgccccggcccggtcatg
gtggagctggcggaaaagctggtaaacaccgtggcgcagatggactgggccttttttgcc
aaaaacggcaacgacgtcacctcctacgccctgatggtggcccgccacgccacgggcaga
aaaaagatcgtggccattcgcggcggataccacggcaccgcgccctgggcacagaccttc
ggccatcatggcgtgaccgaagaggacgcggcccacatggtccgcattccctggaatgac
gcggccgcctttgaagcggtgctggagcaatatcccggccagatcgccgggttcatcgcc
accccctaccaccacccggttttcgcggacaacgagatgccggcccagggctactggcaa
aaaatcgaggccctgtgccgcaaacacggcgtggtgctgattgttgacgacattcgctgc
gggttccggctggacctgcggggctcccacgtctatttcggatttacgccggacctggtc
tgcttttgcaaggccatcggcaacgggtatcccatctccgccctgatgggcaccgatgcc
ttaaaatcagcggcggccaaggtgttttacacgggcagctactggttctccgcggttccc
atggcagcggccattgccacgcttgacgagatggcgcgcatcaatgccgcggccgccatg
ctggcctacggcgaaaagctgagagacggcctgatcgagacggcccggcgtcacggctat
gacctgaaggtttccggccatccggccatgccctacctgcgcatcaccgacgacccctcc
ctgatgctgcaccagcgatggtgcggcgaatgtacccggcggggcgcctttttcacttct
caccacaactggtttgtgtcggcggcccataccgaagaagacctggcccgcacccttgaa
atcgcggacgaggcctttgccgtcatcggcgacaacccacaaaagaaatag

DBGET integrated database retrieval system